1. Recombinant Proteins
  2. Cytokines and Growth Factors
  3. CSF & Receptors
  4. G-CSF
  5. CSF3 Protein, Rhesus macaque

CSF3 Protein, a member of the IL-6 superfamily, is a vital granulocyte/macrophage colony-stimulating factor influencing hematopoiesis. It regulates the production, differentiation, and function of granulocytes and monocytes-macrophages, playing a key role in the intricate balance of hematopoietic processes. CSF3's significance within the IL-6 superfamily extends to orchestrating immune system components for optimal functionality. CSF3 Protein, Rhesus macaque is the recombinant Rhesus Macaque-derived CSF3 protein, expressed by E. coli , with tag free.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Price Stock Quantity
Free Sample   Apply now
Free Sample   Apply now
2 μg In-stock
10 μg In-stock
50 μg In-stock
100 μg In-stock
> 100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

CSF3 Protein, a member of the IL-6 superfamily, is a vital granulocyte/macrophage colony-stimulating factor influencing hematopoiesis. It regulates the production, differentiation, and function of granulocytes and monocytes-macrophages, playing a key role in the intricate balance of hematopoietic processes. CSF3's significance within the IL-6 superfamily extends to orchestrating immune system components for optimal functionality. CSF3 Protein, Rhesus macaque is the recombinant Rhesus Macaque-derived CSF3 protein, expressed by E. coli , with tag free.

Background

The CSF3 Protein, belonging to the IL-6 superfamily, is a granulocyte/macrophage colony-stimulating factor that plays a crucial role in hematopoiesis. This cytokine exerts control over the production, differentiation, and function of two interconnected white cell populations in the blood, namely granulocytes and monocytes-macrophages. Specifically, CSF3 induces the generation of granulocytes, contributing to the intricate regulation of hematopoietic processes. As a key member of the IL-6 superfamily, CSF3 holds significance in orchestrating the balance and functionality of essential components within the immune system.

Biological Activity

Fully biologically active when compared to standard. The ED50 as determined by a cell proliferation assay using murine NFS-60 cells is 1.5-50 pg/mL, corresponding to a specific activity of >2.0x107 IU/mg.

Species

Rhesus Macaque

Source

E. coli

Tag

Tag Free

Accession

F7H1Q6 (T31-S207)

Gene ID

/

Molecular Construction
N-term
CSF3 (T31-S207)
Accession # F7H1Q6
C-term
Protein Length

Full Length of Mature Protein

Synonyms
Granulocyte colony-stimulating factor; CSF3
AA Sequence

TPLGPASSLPQSFLLKCLEQVRKIQGDGAALQEKLCATYKLCHPEELVLLRHSLGIPWAPLSSCPSQALQLTGCLSQLHSSLFLYQGLLQALEGISPELSPTLDTLQLDIADFATTIWQQMEDLGMAPALQPTQGAMPAFTSAFQRRAGGVLVASHLQRFLELAYRVLRHLAQS

Predicted Molecular Mass
19.2 kDa
Molecular Weight

Approximately 18-20 kDa, based on SDS-PAGE under reducing conditions.

Purity

≥ 95%, as determined by reducing SDS-PAGE.

Appearance

Lyophilized powder.

Formulation

Lyophilized from a 0.22 μm filtered solution of 50 mM Tris-HCl, 300 mM NaCl, pH 7.4.
Note: For SPR assay, please replace the buffer. Primary amine components (e.g., Tris, imidazole) can affect protein-coupled chips.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Documentation

CSF3 Protein, Rhesus macaque Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

CSF3 Protein, Rhesus macaque

 

Requested Quantity *

Applicant Name *

 

Salutation

Email Address *

 

Phone Number *

Department

 

Organization Name *

City

State

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
CSF3 Protein, Rhesus macaque
Cat. No.:
HY-P71877
Quantity:
MCE Japan Authorized Agent: