CTLA-4 Protein, Cynomolgus (HEK293, His)

CTLA-4 Protein, a pivotal inhibitory receptor, is a primary negative modulator of T-cell responses in immune regulation. Its distinctive property lies in significantly higher affinity for B7 ligands (CD80/CD86) than the stimulatory coreceptor CD28. Outcompeting CD28 for ligand engagement, CTLA-4 exerts a suppressive influence on T-cell activation, mitigating excessive immune responses in the intricate landscape of immune regulation. CTLA-4 Protein, Cynomolgus (HEK293, His) is the recombinant cynomolgus-derived CTLA-4 protein, expressed by HEK293 , with N-6*His labeled tag.

CTLA-4, a pivotal inhibitory receptor, assumes a paramount role as a primary negative modulator of T-cell responses within the intricate landscape of immune regulation. This regulatory function hinges on the distinctive property of CTLA-4 to exhibit significantly higher affinity for its natural B7 family ligands, CD80 and CD86, in comparison to the cognate stimulatory coreceptor CD28. This pronounced difference in binding affinity underscores the capacity of CTLA-4 to outcompete CD28 for ligand engagement, thereby exerting a suppressive influence on T-cell activation and mitigating excessive immune responses.

Cynomolgus

HEK293

N-6*His

Q9BDC4 (A37-S160)

/

Partial

AMHVAQPAVVLANSRGIASFVCEYASPGKATEVRVTVLRQADSQVTEVCAATYMMGNELTFLDDSICTGTSSGNQVNLTIQGLRAMDTGLYICKVELMYPPPYYMGIGNGTQIYVIDPEPCPDS

Approximately 17-25 kDa,based on SDS-PAGE under reducing conditions.

≥ 95%, as determined by reducing SDS-PAGE.

<1 EU/μg, determined by LAL method.