CTLA-4 Protein, Cynomolgus (Biotinylated, HEK293, His-Avi)

CTLA-4 Protein, a pivotal inhibitory receptor, is a primary negative modulator of T-cell responses in immune regulation. Its distinctive property lies in significantly higher affinity for B7 ligands (CD80/CD86) than the stimulatory coreceptor CD28. Outcompeting CD28 for ligand engagement, CTLA-4 exerts a suppressive influence on T-cell activation, mitigating excessive immune responses in the intricate landscape of immune regulation. CTLA-4 Protein, Cynomolgus/Rhesus macaque (Biotinylated, HEK293, His-Avi) is the recombinant cynomolgus, Rhesus Macaque-derived CTLA-4 protein, expressed by HEK293 , with C-Avi, C-His labeled tag. The total length of CTLA-4 Protein, Cynomolgus/Rhesus macaque (Biotinylated, HEK293, His-Avi) is 124 a.a., with molecular weight of 20-26 kDa.

CTLA-4, a pivotal inhibitory receptor, assumes a paramount role as a primary negative modulator of T-cell responses within the intricate landscape of immune regulation. This regulatory function hinges on the distinctive property of CTLA-4 to exhibit significantly higher affinity for its natural B7 family ligands, CD80 and CD86, in comparison to the cognate stimulatory coreceptor CD28. This pronounced difference in binding affinity underscores the capacity of CTLA-4 to outcompete CD28 for ligand engagement, thereby exerting a suppressive influence on T-cell activation and mitigating excessive immune responses.

Immobilized Human B7-1 Fc at 2 μg/mL (100 μL/well) can bind Biotinylated Cynomolgus / Rhesus macaque CTLA-4 Avi-His with a linear range of 2-31 ng/mL.

Cynomolgus

HEK293

C-Avi;C-His

G7PL88 (A37-S160)

/

Partial

Biotin

AMHVAQPAVVLANSRGTASFVCEYASPGKATEVRVTVLRQADSQVTEVCAATYMMGNELTFLDDSICTGTSSGNQVNLTIQGLRAMDTGLYICKVELMYPPPYYMGIGNGTQIYVIDPEPCPDS

20-26 kDa

≥ 95%, as determined by reducing SDS-PAGE.

Lyophilized powder.

Lyophilized a 0.22 μm filtered solution of PBS, pH 7.4. Normally trehalose is added as protectant before lyophilization.

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH₂O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Room temperature in continental US; may vary elsewhere.