CTRL-1 Protein, Human (HEK293, His)
Based on 1 Customer Validation
CTRL-1 protein is an important member of the peptidase S1 family. As a serine protease, it catalyzes the hydrolysis of peptide bonds. CTRL-1 may share conserved features with related proteins that play important roles in cellular processes related to proteolysis and regulation of biological pathways. CTRL-1 Protein, Human (HEK293, His) is the recombinant human-derived CTRL-1 protein, expressed by HEK293 , with C-6*His labeled tag.
- Species: Human
- Source: HEK293
-
Storage:Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.
To place orders, for customer services and technical support, please contact: MedChemExpress USA
Tel: 609-228-6898 E-mail: [email protected] [email protected]
-
Biological Activity
-
Technical Parameters
-
Product Properties
- Documentation
- Help & FAQs
Biological Activity
CTRL-1 protein is an important member of the peptidase S1 family. As a serine protease, it catalyzes the hydrolysis of peptide bonds. CTRL-1 may share conserved features with related proteins that play important roles in cellular processes related to proteolysis and regulation of biological pathways. CTRL-1 Protein, Human (HEK293, His) is the recombinant human-derived CTRL-1 protein, expressed by HEK293 , with C-6*His labeled tag.
The CTRL-1 Protein is an essential member of the peptidase S1 family, signifying its crucial role as a serine protease enzyme. As part of this enzyme family, CTRL-1 likely shares conserved structural and functional features with related proteins, indicating its involvement in catalyzing the hydrolysis of peptide bonds. The membership in the peptidase S1 family underscores its significance in cellular processes related to proteolysis and the regulation of various biological pathways. The study of CTRL-1 provides insights into its specific enzymatic functions within the context of the peptidase S1 family, offering potential applications in therapeutic interventions and a deeper understanding of its broader impact on cellular processes involved in protein metabolism. Further exploration of CTRL-1's role promises to enhance our comprehension of its contributions to normal physiology and pathological conditions.
The enzyme activity of this recombinant protein is testing in progress, we cannot offer a guarantee yet.
Technical Parameters
-
Species Human
-
Source HEK293
-
Tag C-6*His
-
Accession
P40313 (C19-N264)
-
Molecular Construction
-
N-term
-
CTRL-1 (C19-N264)
Accession # P40313 -
6*His
-
C-term
-
-
Protein Length
Full Length of Mature Protein
-
Synonyms
CTRL; Chymotrypsin-Like Protease; Chymotrypsin Like; Chymotrypsin-Like; CTRL1; CTRL Protein; Chymotrypsin-Like Protease CTRL-1
-
AA Sequence
CGIPAIKPALSFSQRIVNGENAVLGSWPWQVSLQDSSGFHFCGGSLISQSWVVTAAHCNVSPGRHFVVLGEYDRSSNAEPLQVLSVSRAITHPSWNSTTMNNDVTLLKLASPAQYTTRISPVCLASSNEALTEGLTCVTTGWGRLSGVGNVTPAHLQQVALPLVTVNQCRQYWGSSITDSMICAGGAGASSCQGDSGGPLVCQKGNTWVLIGIVSWGTKNCNVRAPAVYTRVSKFSTWINQVIAYN
-
Predicted Molecular Mass
27.2 kDa
-
Molecular Weight
Approximately 28-38 kDa, based on SDS-PAGE under reducing conditions.
-
Glycosylation
Yes
-
Purity
≥ 95%, as determined by reducing SDS-PAGE.
Product Properties
Solution
Supplied as a 0.22 μm filtered solution of 20 mM Tris-HCl, 150 mM NaCl, 10% glycerol, pH 8.0.
Note: For SPR assay, please replace the buffer. Primary amine components (e.g., Tris, imidazole) can affect protein-coupled chips.
<1 EU/μg, determined by LAL method.
Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.
Shipping with dry ice.
Documentation
-
Data Sheet (237 KB)
-
SDS (251 KB)
- English - EN (251 KB)
- Français - FR (251 KB)
- Deutsch - DE (251 KB)
- Norwegian - NO (251 KB)
- Español - ES (251 KB)
- Swedish - SV (251 KB)
- Italian - IT (251 KB)
- Korean - KR (251 KB)
- Portuguese - PT (251 KB)
-
Handling Instructions (2659 KB)
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
Powered by Bioz
