1. Recombinant Proteins
  2. Enzymes & Regulators
  3. Hydrolases (EC 3)
  4. CTSF Protein, Human (His)

CTSF Protein, Human (His)

Cat. No.: HY-P71701
Handling Instructions

CTSF Protein, a thiol protease, participates in intracellular protein degradation and turnover. Its association with tumor invasion and metastasis suggests potential involvement in critical cellular processes related to cancer progression. CTSF Protein, Human (His) is the recombinant human-derived CTSF protein, expressed by E. coli , with N-His labeled tag. The total length of CTSF Protein, Human (His) is 212 a.a., with molecular weight of ~27.4 kDa.

For research use only. We do not sell to patients.

Protein Expression Service

Size Stock
50 μg   Get quote  
100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

CTSF Protein, a thiol protease, participates in intracellular protein degradation and turnover. Its association with tumor invasion and metastasis suggests potential involvement in critical cellular processes related to cancer progression. CTSF Protein, Human (His) is the recombinant human-derived CTSF protein, expressed by E. coli , with N-His labeled tag. The total length of CTSF Protein, Human (His) is 212 a.a., with molecular weight of ~27.4 kDa.

Background

CTSF Protein, a thiol protease, is implicated in intracellular protein degradation and turnover. Additionally, this enzyme has been associated with tumor invasion and metastasis, suggesting its potential involvement in critical cellular processes related to cancer progression.

Species

Human

Source

E. coli

Tag

N-His

Accession

Q9UBX1 (273P-484D)

Gene ID
Molecular Construction
N-term
His
CTSF (273P-484D)
Accession # Q9UBX1
C-term
Synonyms
Cathepsin F; CathepsinF; CATSF; CLN13; Ctsf
AA Sequence

PEWDWRSKGAVTKVKDQGMCGSCWAFSVTGNVEGQWFLNQGTLLSLSEQELLDCDKMDKACMGGLPSNAYSAIKNLGGLETEDDYSYQGHMQSCNFSAEKAKVYINDSVELSQNEQKLAAWLAKRGPISVAINAFGMQFYRHGISRPLRPLCSPWLIDHAVLLVGYGNRSDVPFWAIKNSWGTDWGEKGYYYLHRGSGACGVNTMASSAVVD

Molecular Weight

Approximately 27.4 kDa

Purity

Greater than 90% as determined by reducing SDS-PAGE.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Documentation

CTSF Protein, Human (His) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Salutation

Applicant Name *

 

Email Address *

Phone Number *

 

Organization Name *

Department *

 

Requested quantity *

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
CTSF Protein, Human (His)
Cat. No.:
HY-P71701
Quantity:
MCE Japan Authorized Agent: