2. Recombinant Proteins
  3. Cytokines and Growth Factors
  4. Chemokine & Receptors
  5. CXC Chemokines
  6. GRO-alpha
  7. GRO-alpha/CXCL1 Protein, Mouse (His)

GRO-alpha/CXCL1 Protein, Mouse (His)

Cat. No.: HY-P700559
Handling Instructions

GRO-alpha (CXCL1) Protein, with chemotactic properties, attracts and activates neutrophils during inflammatory responses. This hematoregulatory chemokine also suppresses hematopoietic progenitor cell proliferation, emphasizing its intricate role in hematopoiesis regulation. The truncated form KC(5-72) notably exhibits significantly enhanced hematopoietic activity in vitro. GRO-alpha/CXCL1 Protein, Mouse (His) is the recombinant mouse-derived GRO-alpha/CXCL1 protein, expressed by E. coli , with N-6*His labeled tag. The total length of GRO-alpha/CXCL1 Protein, Mouse (His) is 68 a.a., with molecular weight of 11.5 kDa.

For research use only. We do not sell to patients.

Protein Expression Service

Size Stock
50 μg   Get quote  
100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products

  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

GRO-alpha (CXCL1) Protein, with chemotactic properties, attracts and activates neutrophils during inflammatory responses. This hematoregulatory chemokine also suppresses hematopoietic progenitor cell proliferation, emphasizing its intricate role in hematopoiesis regulation. The truncated form KC(5-72) notably exhibits significantly enhanced hematopoietic activity in vitro. GRO-alpha/CXCL1 Protein, Mouse (His) is the recombinant mouse-derived GRO-alpha/CXCL1 protein, expressed by E. coli , with N-6*His labeled tag. The total length of GRO-alpha/CXCL1 Protein, Mouse (His) is 68 a.a., with molecular weight of 11.5 kDa.
Background

GRO-alpha (CXCL1) Protein exhibits chemotactic properties, attracting neutrophils and contributing to their activation during inflammatory responses. Additionally, this hematoregulatory chemokine displays the ability to suppress the proliferation of hematopoietic progenitor cells, highlighting its intricate role in regulating hematopoiesis. Notably, the truncated form KC(5-72) exhibits significantly enhanced hematopoietic activity in vitro.
Species

Mouse
Source

E. coli
Tag

N-6*His
Accession

P12850 (N29-K96)
Gene ID

14825  [NCBI]
Molecular Construction
N-term
6*His
CXCL1 (N29-K96)
Accession # P12850
C-term
Synonyms
Growth-Regulated Alpha Protein; C-X-C Motif Chemokine 1; GRO-Alpha(1-73); Melanoma Growth Stimulatory Activity; MGSA; Neutrophil-Activating Protein 3; NAP-3; CXCL1; GRO; GRO1; GROA; MGSA; SCYB1
AA Sequence

NELRCQCLQTMAGIHLKNIQSLKVLPSGPHCTQTEVIATLKNGREACLDPEAPLVQKIVQKMLKGVPK

Molecular Weight

11.5 kDa
Purity

Greater than 90% as determined by reducing SDS-PAGE.
Endotoxin Level

<1 EU/μg, determined by LAL method.
Documentation
Handling Instructions (2659 KB)

GRO-alpha/CXCL1 Protein, Mouse (His) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

  

Salutation

Applicant Name *

 

Email Address *

Phone Number *

 

Organization Name *

Department *

 

Requested quantity *

Country or Region *

      

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
GRO-alpha/CXCL1 Protein, Mouse (His)
Cat. No.:
HY-P700559
Quantity:
MCE Japan Authorized Agent:

Request for HNMR Report

Please fill out this form to request the QC report. We will send it to your Email address shortly.

Your information is safe with us. * Required Fields.

Product Name

  

Lot #

Applicant Name *

 

Country or Region *

Email Address *

     

Phone Number *

 

Organization Name *

Remarks

Request for HNMR Report

We have received your request and will respond to you as soon as possible.