GRO-alpha/CXCL1 Protein, Mouse (His)
GRO-alpha (CXCL1) Protein, with chemotactic properties, attracts and activates neutrophils during inflammatory responses. This hematoregulatory chemokine also suppresses hematopoietic progenitor cell proliferation, emphasizing its intricate role in hematopoiesis regulation. The truncated form KC(5-72) notably exhibits significantly enhanced hematopoietic activity in vitro. GRO-alpha/CXCL1 Protein, Mouse (His) is the recombinant mouse-derived GRO-alpha/CXCL1 protein, expressed by E. coli , with N-6*His labeled tag.
- Species: Mouse
- Source: E. coli
-
Storage:Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
To place orders, for customer services and technical support, please contact: MedChemExpress USA
Tel: 609-228-6898 E-mail: [email protected] [email protected]
-
Biological Activity
-
Technical Parameters
-
Product Properties
- Documentation
- Help & FAQs
Biological Activity
GRO-alpha (CXCL1) Protein, with chemotactic properties, attracts and activates neutrophils during inflammatory responses. This hematoregulatory chemokine also suppresses hematopoietic progenitor cell proliferation, emphasizing its intricate role in hematopoiesis regulation. The truncated form KC(5-72) notably exhibits significantly enhanced hematopoietic activity in vitro. GRO-alpha/CXCL1 Protein, Mouse (His) is the recombinant mouse-derived GRO-alpha/CXCL1 protein, expressed by E. coli , with N-6*His labeled tag.
GRO-alpha (CXCL1) Protein exhibits chemotactic properties, attracting neutrophils and contributing to their activation during inflammatory responses. Additionally, this hematoregulatory chemokine displays the ability to suppress the proliferation of hematopoietic progenitor cells, highlighting its intricate role in regulating hematopoiesis. Notably, the truncated form KC(5-72) exhibits significantly enhanced hematopoietic activity in vitro.
Technical Parameters
-
Species Mouse
-
Source E. coli
-
Tag N-6*His
-
Accession
P12850 (N29-K96)
-
Molecular Construction
-
N-term
-
6*His
-
CXCL1 (N29-K96)
Accession # P12850 -
C-term
-
-
Protein Length
Partial
-
Synonyms
CXCL1; Neutrophil-Activating Protein 3; Prev. GRO1; Fibroblast Secretory Protein; Prev. MGSA; C-X-C Motif Chemokine 1; Prev. FSP; GRO-Alpha(1-73); SCYB1; GRO1 Oncogene (Melanoma Growth-Stimulating Activity); NAP-3; Melanoma Growth Stimulatory Activity Alp
-
AA Sequence
NELRCQCLQTMAGIHLKNIQSLKVLPSGPHCTQTEVIATLKNGREACLDPEAPLVQKIVQKMLKGVPK
-
Predicted Molecular Mass
11.5 kDa
-
Purity
≥ 90%, as determined by reducing SDS-PAGE.
Product Properties
Lyophilized powder.
<1 EU/μg, determined by LAL method.
It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O.
Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Room temperature in continental US; may vary elsewhere.
Documentation
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
Powered by Bioz
