IL-8/CXCL8 Protein, Rhesus macaque (His)
Based on 1 Customer Validation
CXCL8 protein, a crucial chemotactic factor, drives inflammatory responses by attracting neutrophils, basophils, and T-cells, contributing to pathogen clearance. It plays a pivotal role in activating neutrophils and binds to CXCR1/CXCR2 receptors, initiating downstream signaling pathways. CXCL8 homodimerizes and interacts with TNFAIP6, potentially regulating chemokine activity in the inflammatory microenvironment. IL-8/CXCL8 Protein, Rhesus macaque (His) is the recombinant Rhesus Macaque-derived CXCL8 protein, expressed by E. coli , with N-6*His labeled tag.
- Species: Rhesus Macaque
- Source: E. coli
-
Storage:Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
To place orders, for customer services and technical support, please contact: MedChemExpress USA
Tel: 609-228-6898 E-mail: [email protected] [email protected]
-
Biological Activity
-
Technical Parameters
-
Product Properties
- Documentation
- Help & FAQs
Biological Activity
Description
CXCL8 protein, a crucial chemotactic factor, drives inflammatory responses by attracting neutrophils, basophils, and T-cells, contributing to pathogen clearance. It plays a pivotal role in activating neutrophils and binds to CXCR1/CXCR2 receptors, initiating downstream signaling pathways. CXCL8 homodimerizes and interacts with TNFAIP6, potentially regulating chemokine activity in the inflammatory microenvironment. IL-8/CXCL8 Protein, Rhesus macaque (His) is the recombinant Rhesus Macaque-derived CXCL8 protein, expressed by E. coli , with N-6*His labeled tag.
Background
CXCL8 protein functions as a critical chemotactic factor that orchestrates the inflammatory response by attracting neutrophils, basophils, and T-cells, thereby aiding in the clearance of pathogens and safeguarding the host from infections. Additionally, CXCL8 plays a pivotal role in activating neutrophils. Upon release in response to inflammatory stimuli, CXCL8 exerts its effects by binding to the G-protein-coupled receptors CXCR1 and CXCR2, predominantly present in neutrophils, monocytes, and endothelial cells. The G-protein heterotrimer (alpha, beta, gamma subunits) constitutively binds to the CXCR1/CXCR2 receptor, and activation by CXCL8 results in the release of beta and gamma subunits from Galpha (GNAI2 in neutrophils), subsequently activating various downstream signaling pathways, including PI3K and MAPK pathways. CXCL8 forms homodimers, and its interaction with TNFAIP6 via the Link domain interferes with chemokine binding to glycosaminoglycans, suggesting a regulatory role in modulating chemokine activity within the inflammatory microenvironment.
Verified Bioactivity
Measured in a cell proliferation assay using HUVEC human umbilical vein endothelial cells.The ED50 for this effect is 5-25 ng/mL.
MCE Validation Data
-
Purity - SDS-PAGE
Purity - SDS-PAGE
-
Bioactivity - Cell-Based Assay
Bioactivity - Cell-Based Assay
Technical Parameters
-
Species Rhesus Macaque
-
Source E. coli
-
Tag N-6*His
-
Accession
P67813 (A23-P101)
-
Molecular Construction
-
N-term
-
6*His
-
CXCL8 (A23-P101)
Accession # P67813 -
C-term
-
-
Protein Length
Full Length of Mature Protein
-
Synonyms
CXCL8; Lung Giant Cell Carcinoma-Derived Chemotactic Protein; Prev. IL8; Alveolar Macrophage Chemotactic Factor I; MDNCF; Tumor Necrosis Factor-Induced Gene 1; NAP-1; Neutrophil-Activating Peptide 1; MONAP; T-Cell Chemotactic Factor; GCP-1; Interleukin 8;
-
AA Sequence
AVLPRSAKELRCECIKTYSKPFHPKFIKELRVIESGPHCANTEIIVKLSDGRELCLDPKEPWVQRVVEKFVKRAENQNP
-
Predicted Molecular Mass
9.1 kDa
-
Molecular Weight
Approximately 11 kDa, based on SDS-PAGE under reducing conditions.
-
Purity
≥ 95%, as determined by reducing SDS-PAGE.
Product Properties
Lyophilized powder.
Lyophilized from a 0.22 μm filtered solution of 50 mM Tris-HCl, 300 mM NaCl, pH 7.4.
Note: For SPR assay, please replace the buffer. Primary amine components (e.g., Tris, imidazole) can affect protein-coupled chips.
<1 EU/μg, determined by LAL method.
It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).
Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Room temperature in continental US; may vary elsewhere.
Documentation
-
Data Sheet (236 KB)
-
SDS (252 KB)
- English - EN (252 KB)
- Français - FR (252 KB)
- Deutsch - DE (252 KB)
- Norwegian - NO (252 KB)
- Español - ES (252 KB)
- Swedish - SV (252 KB)
- Italian - IT (252 KB)
- Korean - KR (252 KB)
- Portuguese - PT (252 KB)
-
Handling Instructions (2659 KB)
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
Powered by Bioz
