CXCL8 Protein, Rhesus macaque (His)

CXCL8 protein, a crucial chemotactic factor, drives inflammatory responses by attracting neutrophils, basophils, and T-cells, contributing to pathogen clearance. It plays a pivotal role in activating neutrophils and binds to CXCR1/CXCR2 receptors, initiating downstream signaling pathways. CXCL8 homodimerizes and interacts with TNFAIP6, potentially regulating chemokine activity in the inflammatory microenvironment. CXCL8 Protein, Rhesus macaque (His) is the recombinant Rhesus Macaque-derived CXCL8 protein, expressed by E. coli , with N-6*His labeled tag. The total length of CXCL8 Protein, Rhesus macaque (His) is 79 a.a., with molecular weight of ~11 kDa.

CXCL8 protein functions as a critical chemotactic factor that orchestrates the inflammatory response by attracting neutrophils, basophils, and T-cells, thereby aiding in the clearance of pathogens and safeguarding the host from infections. Additionally, CXCL8 plays a pivotal role in activating neutrophils. Upon release in response to inflammatory stimuli, CXCL8 exerts its effects by binding to the G-protein-coupled receptors CXCR1 and CXCR2, predominantly present in neutrophils, monocytes, and endothelial cells. The G-protein heterotrimer (alpha, beta, gamma subunits) constitutively binds to the CXCR1/CXCR2 receptor, and activation by CXCL8 results in the release of beta and gamma subunits from Galpha (GNAI2 in neutrophils), subsequently activating various downstream signaling pathways, including PI3K and MAPK pathways. CXCL8 forms homodimers, and its interaction with TNFAIP6 via the Link domain interferes with chemokine binding to glycosaminoglycans, suggesting a regulatory role in modulating chemokine activity within the inflammatory microenvironment.

Measured in a cell proliferation assay using HUVEC human umbilical vein endothelial cells.The ED₅₀ for this effect is 8.054-11.39 ng/mL, corresponding to a specific activity is 1.24×10⁵ to 8.78×10⁴ units/mg.

• 
  Measured in a cell proliferation assay using HUVEC human umbilical vein endothelial cells.The ED₅₀ for this effect is 8.054-11.39 ng/mL, corresponding to a specific activity is 1.24×10⁵ to 8.78×10⁴ units/mg.

Rhesus Macaque

E. coli

N-6*His

P67813 (A23-P101)

613028  [NCBI]

AVLPRSAKELRCECIKTYSKPFHPKFIKELRVIESGPHCANTEIIVKLSDGRELCLDPKEPWVQRVVEKFVKRAENQNP

Approximately 11 kDa

• 
  Greater than 95% as determined by reducing SDS-PAGE.

Lyophilized powder.

Lyophilized from a 0.2 μm filtered solution of 50 mM Tris-HCL, 300 mM NaCl, pH 7.4.

<1 EU/μg, determined by LAL method.

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH₂O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Stored at -20°C for 2 years. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Room temperature in continental US; may vary elsewhere.