CXCR2 Protein, Human (His-SUMO)
Based on 1 Customer Validation
CXCR2, the receptor for interleukin-8 (IL-8), orchestrates neutrophil activation through a G-protein-mediated phosphatidylinositol-calcium second messenger system upon IL-8 binding. Exhibiting high-affinity binding to IL-8, CXCR2 also interacts with other ligands like CXCL3, GRO/MGSA, and NAP-2. The involvement of GNAI2 underscores the intricate signaling mechanisms regulating neutrophil function through CXCR2. CXCR2 Protein, Human (His-SUMO) is the recombinant human-derived CXCR2 protein, expressed by E. coli , with N-SUMO, N-6*His labeled tag.
- Species: Human
- Source: E. coli
-
Storage:Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
To place orders, for customer services and technical support, please contact: MedChemExpress USA
Tel: 609-228-6898 E-mail: [email protected] [email protected]
-
Biological Activity
-
Technical Parameters
-
Product Properties
- Documentation
- Help & FAQs
Biological Activity
Description
CXCR2, the receptor for interleukin-8 (IL-8), orchestrates neutrophil activation through a G-protein-mediated phosphatidylinositol-calcium second messenger system upon IL-8 binding. Exhibiting high-affinity binding to IL-8, CXCR2 also interacts with other ligands like CXCL3, GRO/MGSA, and NAP-2. The involvement of GNAI2 underscores the intricate signaling mechanisms regulating neutrophil function through CXCR2. CXCR2 Protein, Human (His-SUMO) is the recombinant human-derived CXCR2 protein, expressed by E. coli , with N-SUMO, N-6*His labeled tag.
Background
CXCR2, the receptor for interleukin-8 (IL-8), a potent neutrophil chemotactic factor, orchestrates the activation of neutrophils upon IL-8 binding. This response is mediated through a G-protein, initiating a phosphatidylinositol-calcium second messenger system. CXCR2 exhibits high-affinity binding not only to IL-8 but also to other ligands such as CXCL3, GRO/MGSA, and NAP-2. The interaction with IL-8 and GNAI2 further highlights the intricate signaling mechanisms involved in the regulation of neutrophil function by CXCR2.
Technical Parameters
-
Species Human
-
Source E. coli
-
Tag N-SUMO;N-6*His
-
Accession
P25025 (M1-E40)
-
Molecular Construction
-
N-term
-
6*His-SUMO
-
CXCR2 (M1-E40)
Accession # P25025 -
C-term
-
-
Protein Length
Partial Extracellular Domain
-
Synonyms
CXCR2; IL-8R B; Prev. IL8RB; CXCR-2; High Affinity Interleukin-8 Receptor B; Chemokine (C-X-C Motif) Receptor 2; C-X-C Chemokine Receptor Type 2; CXCR2 Gene For IL8 Receptor Type B; CMKAR2; Interleukin 8 Receptor Type 2; CD182; Chemokine (CXC) Receptor 2;
-
AA Sequence
MEDFNMESDSFEDFWKGEDLSNYSYSSTLPPFLLDAAPCE
-
Predicted Molecular Mass
20.6 kDa
-
Molecular Weight
Approximately 23-25 kDa, based on SDS-PAGE under reducing conditions.
-
Purity
≥ 90%, as determined by reducing SDS-PAGE.
Product Properties
Lyophilized powder
Lyophilized from a 0.2 μm filtered solution of Tris-based buffer, 50% glycerol, 6% Trehalose, pH 8.0 or PBS, 6% Trehalose, pH 7.4.
<1 EU/μg, determined by LAL method.
It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O.
Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Room temperature in continental US; may vary elsewhere.
Documentation
-
Data Sheet (232 KB)
-
SDS (252 KB)
- English - EN (252 KB)
- Français - FR (252 KB)
- Deutsch - DE (252 KB)
- Norwegian - NO (252 KB)
- Español - ES (252 KB)
- Swedish - SV (252 KB)
- Italian - IT (252 KB)
- Korean - KR (252 KB)
- Portuguese - PT (252 KB)
-
Handling Instructions (2659 KB)
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
Powered by Bioz
