Cyclin-H/CCNH Protein, Human (His)

Cyclin-H/CCNH plays a key role as a modulator of CDK7, the catalytic subunit of the CDK-activated kinase (CAK) complex. This enzyme complex activates cyclin-related kinases such as CDK1, CDK2, CDK4, and CDK6 through threonine phosphorylation. Cyclin-H/CCNH Protein, Human (His) is the recombinant human-derived Cyclin-H/CCNH protein, expressed by E. coli , with N-6*His labeled tag. The total length of Cyclin-H/CCNH Protein, Human (His) is 323 a.a., with molecular weight of 34-39 kDa.

The Cyclin-H/CCNH protein functions as a pivotal regulator of CDK7, the catalytic subunit of the CDK-activating kinase (CAK) enzymatic complex. CAK, in turn, plays a crucial role in activating cyclin-associated kinases such as CDK1, CDK2, CDK4, and CDK6 through threonine phosphorylation. In association with the core-TFIIH basal transcription factor, CAK facilitates RNA polymerase II activation by serine phosphorylation of the repetitive C-terminal domain (CTD) of its large subunit (POLR2A), allowing the polymerase to escape from the promoter and initiate transcript elongation. Cyclin-H/CCNH is actively involved in cell cycle control and RNA transcription by RNA polymerase II, with its expression and activity remaining constant throughout the cell cycle. It primarily associates with CDK7 and MAT1 to form the CAK complex, which, in turn, can further associate with the core-TFIIH to constitute the TFIIH basal transcription factor. These regulatory interactions highlight Cyclin-H/CCNH's central role in coordinating key cellular processes essential for proper cell cycle progression and transcriptional control.

Human

E. coli

N-6*His

P51946 (M1-L323)

902  [NCBI]

MYHNSSQKRHWTFSSEEQLARLRADANRKFRCKAVANGKVLPNDPVFLEPHEEMTLCKYYEKRLLEFCSVFKPAMPRSVVGTACMYFKRFYLNNSVMEYHPRIIMLTCAFLACKVDEFNVSSPQFVGNLRESPLGQEKALEQILEYELLLIQQLNFHLIVHNPYRPFEGFLIDLKTRYPILENPEILRKTADDFLNRIALTDAYLLYTPSQIALTAILSSASRAGITMESYLSESLMLKENRTCLSQLLDIMKSMRNLVKKYEPPRSEEVAVLKQKLERCHSAELALNVITKKRKGYEDDDYVSKKSKHEEEEWTDDDLVESL

34-39 kDa

Greater than 95% as determined by reducing SDS-PAGE

Solution.

Supplied as a 0.2 μm filtered solution of 20 mM Tris-HCl, 100 mM NaCl, 2 mM EDTA, 2 mM DTT, 30% Glycerol, pH 8.5.

<1 EU/μg, determined by LAL method.

Stored at -80°C for 1 year. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.

Shipping with dry ice.