Cystatin B/CST8 Protein, Human (HEK293, Fc)

Cystatin B/CST8 Protein specializes in sperm development and maturation. Cystatin B/CST8 Protein, Human (HEK293, Fc) is the recombinant human-derived Cystatin B/CST8 protein, expressed by HEK293 , with C-hFc labeled tag. The total length of Cystatin B/CST8 Protein, Human (HEK293, Fc) is 142 a.a., with molecular weight of ~43-55 KDa.

Cystatin B/CST8 Protein plays a specialized role during sperm development and maturation.

Measured by its ability to inhibit papain cleavage of a fluorogenic peptide substrate Z-FR-AMC. The IC₅₀ value is 4.188 nM, as measured under the described conditions.

Human

HEK293

C-hFc

O60676 (K22-A142)

10047  [NCBI]

KDPKKNETGVLRKLKPVNASNANVKQCLWFAMQEYNKESEDKYVFLVVKTLQAQLQVTNLLEYLIDVEIARSDCRKPLSTNEICAIQENSKLKRKLSCSFLVGALPWNGEFTVMEKKCEDA

Approximately 43-55 kDa due to the glycosylation

Greater than 90% as determined by reducing SDS-PAGE.

Lyophilized powder.

Lyophilized from a 0.2 μm filtered solution of PBS, pH 7.4.

<1 EU/μg, determined by LAL method.

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH₂O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Stored at -20°C for 2 years. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Room temperature in continental US; may vary elsewhere.