1. Recombinant Proteins
  2. DCIP-1/CXCL3 Protein, Mouse (CHO)

DCIP-1/CXCL3 Protein, Mouse (CHO)

Cat. No.: HY-P7337
Handling Instructions

DCIP-1/CXCL3 Protein, Mouse (CHO) acts as a chemoattractant for neutrophils and is involved in the inflammatory response produced in CHO cells.

For research use only. We do not sell to patients.

Protein Expression Service

Recombinant Proteins-MedChemExpress
Size Price Stock
10 μg $160 Ask For Quote & Lead Time

* Please select Quantity before adding items.

  • Technical Parameters

  • Properties

  • Documentation

Synonyms
rMuDCIP-1/CXCL3; C-X-C motif chemokine 3; Dendritic cell inflammatory protein 1
Species

Mouse

Source

CHO

Accession

Q6W5C0 (A28-S100)

Gene ID

330122

Molecular Weight

Approximately 8 kDa

AA Sequence

AVVASELRCQCLNTLPRVDFETIQSLTVTPPGPHCTQTEVIATLKDGQEVCLNPQGPRLQIIIKKILKSGKSS

Biological Activity
The EC50 is <100 ng/mL as measured on Ca2+ mobilization assay in CHO-K1/Gα15/mCXCR2 cells (human Gα15 and mCXCR2 stably expressed in CHO-K1 cells).
Appearance

Lyophilized powder.

Formulation

Lyophilized after extensive dialysis against PBS.

Endotoxin Level

<0.2 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O or PBS.

Storage & Stability

Stored at -20°C. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer. It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Background

Chemokine (C-X-C motif) ligand 3 (CXCL3) is a small cytokine belonging to the CXC chemokine family. CXCL3 controls migration and adhesion of monocytes and mediates its effects on its target cell by interacting with a cell surface chemokine receptor[1]. It has been shown that CXCL3 regulates cell autonomously the migration of the precursors of cerebellar granule neurons toward the internal layers of cerebellum, during the morphogenesis of cerebellum[2].

Documentation
References
  • Molarity Calculator

  • Dilution Calculator

The molarity calculator equation

Mass (g) = Concentration (mol/L) × Volume (L) × Molecular Weight (g/mol)

Mass   Concentration   Volume   Molecular Weight *
= × ×

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Salutation

Applicant Name *

 

Email address *

Phone number *

 

Organization name *

Department *

 

Requested quantity *

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
DCIP-1/CXCL3 Protein, Mouse (CHO)
Cat. No.:
HY-P7337
Quantity:
MCE Japan Authorized Agent: