1. Recombinant Proteins
  2. Others
  3. DCN1-like protein 1/DCUN1D1 Protein, Human (His)

DCN1-like protein 1/DCUN1D1 Protein, Human (His)

Cat. No.: HY-P70093
Handling Instructions

DCN1-like protein 1 (DCUN1D1) is an important component of the E3 ubiquitin ligase complex and promotes neddylation of the cullin component within the E3 cullin-RING ubiquitin ligase complex. By binding to the cullin-RBX1 complex in the cytoplasm, DCUN1D1 promotes its nuclear translocation, enhances E2-NEDD8 thioester recruitment, and optimizes protein orientation for efficient NEDD8 transfer. DCN1-like protein 1/DCUN1D1 Protein, Human (His) is the recombinant human-derived DCN1-like protein 1/DCUN1D1 protein, expressed by E. coli , with N-6*His labeled tag. The total length of DCN1-like protein 1/DCUN1D1 Protein, Human (His) is 259 a.a., with molecular weight of ~32.0 kDa.

For research use only. We do not sell to patients.

Protein Expression Service

Size Stock
50 μg   Get quote  
100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

DCN1-like protein 1 (DCUN1D1) is an important component of the E3 ubiquitin ligase complex and promotes neddylation of the cullin component within the E3 cullin-RING ubiquitin ligase complex. By binding to the cullin-RBX1 complex in the cytoplasm, DCUN1D1 promotes its nuclear translocation, enhances E2-NEDD8 thioester recruitment, and optimizes protein orientation for efficient NEDD8 transfer. DCN1-like protein 1/DCUN1D1 Protein, Human (His) is the recombinant human-derived DCN1-like protein 1/DCUN1D1 protein, expressed by E. coli , with N-6*His labeled tag. The total length of DCN1-like protein 1/DCUN1D1 Protein, Human (His) is 259 a.a., with molecular weight of ~32.0 kDa.

Background

DCN1-like protein 1 (DCUN1D1) functions as a crucial component of an E3 ubiquitin ligase complex involved in neddylation, facilitating the neddylation of cullin components within E3 cullin-RING ubiquitin ligase complexes. Operating by binding to cullin-RBX1 complexes in the cytoplasm, DCUN1D1 promotes their nuclear translocation, enhances the recruitment of E2-NEDD8 thioester to the complex, and optimizes the orientation of proteins for efficient NEDD8 transfer from E2 to cullin substrates. Furthermore, DCUN1D1 plays a pivotal role in releasing the inhibitory effects of CAND1 on cullin-RING ligase E3 complex assembly and activity. Beyond its role in cellular processes, DCUN1D1 acts as an oncogene, contributing to malignant transformation and carcinogenic progression. It forms part of an E3 complex for neddylation composed of cullins, RBX1, UBE2M, and CAND1, displaying dynamic interactions with various components, including neddylated cullins, RBX1, UBE2M, UBE2F, CAND1, and additional regulators or subunits of cullin-RING ligases, exemplifying its intricate involvement in cellular ubiquitination pathways.

Species

Human

Source

E. coli

Tag

N-6*His

Accession

Q96GG9 (M1-V259)

Gene ID
Molecular Construction
N-term
6*His
DCUN1D1 (M1-V259)
Accession # Q96GG9
C-term
Synonyms
rHuDCN1-like protein 1/DCUN1D1, His; DCN1-Like Protein 1; DCUN1 Domain-Containing Protein 1; Defective in Cullin Neddylation Protein 1-Like Protein 1; Squamous Cell Carcinoma-Related Oncogene; DCUN1D1; DCUN1L1; RP42; SCCRO
AA Sequence

MNKLKSSQKDKVRQFMIFTQSSEKTAVSCLSQNDWKLDVATDNFFQNPELYIRESVKGSLDRKKLEQLYNRYKDPQDENKIGIDGIQQFCDDLALDPASISVLIIAWKFRAATQCEFSKQEFMDGMTELGCDSIEKLKAQIPKMEQELKEPGRFKDFYQFTFNFAKNPGQKGLDLEMAIAYWNLVLNGRFKFLDLWNKFLLEHHKRSIPKDTWNLLLDFSTMIADDMSNYDEEGAWPVLIDDFVEFARPQIAGTKSTTV

Molecular Weight

Approximately 32.0 kDa

Purity

Greater than 95% as determined by reducing SDS-PAGE

Endotoxin Level

<1 EU/μg, determined by LAL method.

Documentation

DCN1-like protein 1/DCUN1D1 Protein, Human (His) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Salutation

Applicant Name *

 

Email Address *

Phone Number *

 

Organization Name *

Department *

 

Requested quantity *

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
DCN1-like protein 1/DCUN1D1 Protein, Human (His)
Cat. No.:
HY-P70093
Quantity:
MCE Japan Authorized Agent: