DDX19A Protein, Human (His-SUMO)
The DDX19A protein is an ATP-dependent RNA helicase that plays a crucial role in unwinding single- and double-stranded DNA in the 3'-5' direction. It is actively involved in DNA replication and repair by recruiting DNA2 to aid in 5' end resection during double-strand break repair. DDX19A Protein, Human (His-SUMO) is the recombinant human-derived DDX19A protein, expressed by E. coli , with N-6*His, N-SUMO labeled tag.
- Species: Human
- Source: E. coli
-
Storage:Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
To place orders, for customer services and technical support, please contact: MedChemExpress USA
Tel: 609-228-6898 E-mail: [email protected] [email protected]
-
Biological Activity
-
Technical Parameters
-
Product Properties
- Documentation
- Help & FAQs
Biological Activity
Description
The DDX19A protein is an ATP-dependent RNA helicase that plays a crucial role in unwinding single- and double-stranded DNA in the 3'-5' direction. It is actively involved in DNA replication and repair by recruiting DNA2 to aid in 5' end resection during double-strand break repair. DDX19A Protein, Human (His-SUMO) is the recombinant human-derived DDX19A protein, expressed by E. coli , with N-6*His, N-SUMO labeled tag.
Background
BLM, an ATP-dependent DNA helicase, exhibits the capability to unwind both single- and double-stranded DNA in a 3'-5' direction. It actively participates in DNA replication and repair processes, playing a vital role in 5'-end resection of DNA during double-strand break repair by unwinding DNA and recruiting DNA2, which facilitates the cleavage of 5'-ssDNA. Additionally, BLM negatively regulates sister chromatid exchange and is involved in stimulating DNA 4-way junction branch migration as well as DNA Holliday junction dissolution. This multifaceted protein binds to single-stranded DNA, forked duplex DNA, and DNA Holliday junctions. Notably, BLM is recruited to DNA replication forks by the KHDC3-OOEP scaffold, where it is retained through TRIM25 ubiquitination, thus promoting the restart of stalled replication forks.
Technical Parameters
-
Species Human
-
Source E. coli
-
Tag N-6*His;N-SUMO
-
Accession
Q9NUU7-1 (M1-N478)
-
Molecular Construction
-
N-term
-
6*His-SUMO
-
DDX19A (M1-N478)
Accession # Q9NUU7-1 -
C-term
-
-
Protein Length
Full Length of Isoform-1
-
Synonyms
DDX19A; DDX19-Like Protein; Prev. DDX19L; FLJ11126; DEAD (Asp-Glu-Ala-Asp) Box Polypeptide 19A; DEAD (Asp-Glu-Ala-As) Box Polypeptide 19-Like; ATP-Dependent RNA Helicase DDX19A; DEAD (Asp-Glu-Ala-As) Box Polypeptide 19A; DEAD Box Protein 19A; DDX19-DDX19L
-
AA Sequence
MATDSWALAVDEQEAAVKSMTNLQIKEEKVKADTNGIIKTSTTAEKTDEEEKEDRAAQSLLNKLIRSNLVDNTNQVEVLQRDPNSPLYSVKSFEELRLKPQLLQGVYAMGFNRPSKIQENALPMMLAEPPQNLIAQSQSGTGKTAAFVLAMLSRVEPSDRYPQCLCLSPTYELALQTGKVIEQMGKFYPELKLAYAVRGNKLERGQKISEQIVIGTPGTVLDWCSKLKFIDPKKIKVFVLDEADVMIATQGHQDQSIRIQRMLPRNCQMLLFSATFEDSVWKFAQKVVPDPNVIKLKREEETLDTIKQYYVLCSSRDEKFQALCNLYGAITIAQAMIFCHTRKTASWLAAELSKEGHQVALLSGEMMVEQRAAVIERFREGKEKVLVTTNVCARGIDVEQVSVVINFDLPVDKDGNPDNETYLHRIGRTGRFGKRGLAVNMVDSKHSMNILNRIQEHFNKKIERLDTDDLDEIEKIAN
-
Predicted Molecular Mass
70 kDa
-
Purity
≥ 90%, as determined by reducing SDS-PAGE.
Product Properties
Lyophilized powder.
<1 EU/μg, determined by LAL method.
It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O.
Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Room temperature in continental US; may vary elsewhere.
Documentation
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
Powered by Bioz
