DDX39B Protein, Human (GST)

The DDX39B protein intricately coordinates nuclear mRNA export and is specifically associated with spliced mRNA as a key component of the TREX complex. This coupling of mRNA transcription, processing, and export involves rounds of ATP-dependent hydrolysis, recruiting components such as ALYREF/THOC and CHTOP. DDX39B Protein, Human (GST) is the recombinant human-derived DDX39B protein, expressed by E. coli , with N-GST labeled tag.

For research use only. We do not sell to patients.
  • Species: Human
  • Source: E. coli
  • Storage:
    Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
  • Biological Activity
  • Technical Parameters
  • Product Properties
  • Documentation
  • Help & FAQs

Biological Activity

Description

The DDX39B protein intricately coordinates nuclear mRNA export and is specifically associated with spliced mRNA as a key component of the TREX complex. This coupling of mRNA transcription, processing, and export involves rounds of ATP-dependent hydrolysis, recruiting components such as ALYREF/THOC and CHTOP. DDX39B Protein, Human (GST) is the recombinant human-derived DDX39B protein, expressed by E. coli , with N-GST labeled tag.

Background

The DDX39B protein is intricately involved in the nuclear export of both spliced and unspliced mRNA. As a crucial component of the TREX complex, it plays a pivotal role in coupling mRNA transcription, processing, and nuclear export, specifically associating with spliced mRNA rather than unspliced pre-mRNA. TREX is recruited to spliced mRNAs through a transcription-independent mechanism, binding to mRNA upstream of the exon-junction complex (EJC) and participating in mRNA export to the cytoplasm through the TAP/NFX1 pathway. During the assembly of TREX, DDX39B may undergo multiple rounds of ATP hydrolysis, driving the subsequent loading of components such as ALYREF/THOC and CHTOP onto mRNA. Additionally, DDX39B is implicated in the nuclear export of intronless mRNA, where its ATP-bound form recruits the export adapter ALYREF/THOC4 to intronless mRNA, with ATP hydrolysis triggering dissociation from RNA, allowing the association of ALYREF/THOC4 and the NXF1-NXT1 heterodimer. Beyond its role in mRNA export, DDX39B is involved in transcription elongation and contributes to genome stability. Functioning as a splice factor, it is essential for the initial ATP-dependent step in spliceosome assembly and the interaction of U2 snRNP with the branchpoint. DDX39B exhibits RNA-stimulated ATP binding/hydrolysis activity and ATP-dependent RNA unwinding activity, with a preference for ssRNA over dsRNA. Notably, its ATPase and helicase activities remain largely unaffected by U2AF2, while the impact of ALYREF/THOC4 stimulation is reported with conflicting findings.

Technical Parameters

  • Species Human
  • Source E. coli
  • Tag N-GST
  • Accession
  • Gene ID
  • Molecular Construction
    • N-term
    • GST
    • DDX39B (A2-V251)
      Accession # Q13838
    • C-term
  • Protein Length

    Partial

  • Synonyms

    DDX39B; DEAD-Box Helicase 39B; Prev. BAT1; HLA-B Associated Transcript 1; D6S81E; Spliceosome RNA Helicase BAT1; Uap56; U2AF65-Associated Protein 56; DEAD (Asp-Glu-Ala-Asp) Box Polypeptide 39B; ATP-Dependent RNA Helicase; HLA-B-Associated Transcript 1 Pro

  • AA Sequence

    AENDVDNELLDYEDDEVETAAGGDGAEAPAKKDVKGSYVSIHSSGFRDFLLKPELLRAIVDCGFEHPSEVQHECIPQAILGMDVLCQAKSGMGKTAVFVLATLQQLEPVTGQVSVLVMCHTRELAFQISKEYERFSKYMPNVKVAVFFGGLSIKKDEEVLKKNCPHIVVGTPGRILALARNKSLNLKHIKHFILDECDKMLEQLDMRRDVQEIFRMTPHEKQVMMFSATLSKEIRPVCRKFMQDPMEIFV

  • Predicted Molecular Mass

    55.2 kDa

  • Purity

    ≥ 90%, as determined by reducing SDS-PAGE.

Product Properties

Appearance

Lyophilized powder.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O.

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Calculators

Reconstitution Calculator

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) Volume (to add to vial)
=
Mass (in vial) Mass (in vial)
÷
Desired Reconstitution Concentration Desired Reconstitution Concentration
Dilution Calculator

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

Concentration (start) Concentration (start)
×
Volume (start) Volume (start)
=
Concentration (final) Concentration (final)
×
Volume (final) Volume (final)
The Specific Activity Calculator Equation
  • Specific Activity (Unit/mg)
  • Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) Specific Activity (Unit/mg)
Unit/mg
= 106 ÷
Biological Activity (ED50) Biological Activity (ED50)
106 ÷
ng/mL
MOQ
Minimum order quantity
100 mg

Get Quote In-stock

Other size
Get Quote
Please select quantity
Amount: USD 0.00