1. Recombinant Proteins
  2. Enzymes & Regulators
  3. Hydrolases (EC 3)
  4. DDX39B Protein, Human (GST)

The DDX39B protein intricately coordinates nuclear mRNA export and is specifically associated with spliced mRNA as a key component of the TREX complex. This coupling of mRNA transcription, processing, and export involves rounds of ATP-dependent hydrolysis, recruiting components such as ALYREF/THOC and CHTOP. DDX39B Protein, Human (GST) is the recombinant human-derived DDX39B protein, expressed by E. coli , with N-GST labeled tag.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Stock
50 μg   Get quote  
100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

The DDX39B protein intricately coordinates nuclear mRNA export and is specifically associated with spliced mRNA as a key component of the TREX complex. This coupling of mRNA transcription, processing, and export involves rounds of ATP-dependent hydrolysis, recruiting components such as ALYREF/THOC and CHTOP. DDX39B Protein, Human (GST) is the recombinant human-derived DDX39B protein, expressed by E. coli , with N-GST labeled tag.

Background

The DDX39B protein is intricately involved in the nuclear export of both spliced and unspliced mRNA. As a crucial component of the TREX complex, it plays a pivotal role in coupling mRNA transcription, processing, and nuclear export, specifically associating with spliced mRNA rather than unspliced pre-mRNA. TREX is recruited to spliced mRNAs through a transcription-independent mechanism, binding to mRNA upstream of the exon-junction complex (EJC) and participating in mRNA export to the cytoplasm through the TAP/NFX1 pathway. During the assembly of TREX, DDX39B may undergo multiple rounds of ATP hydrolysis, driving the subsequent loading of components such as ALYREF/THOC and CHTOP onto mRNA. Additionally, DDX39B is implicated in the nuclear export of intronless mRNA, where its ATP-bound form recruits the export adapter ALYREF/THOC4 to intronless mRNA, with ATP hydrolysis triggering dissociation from RNA, allowing the association of ALYREF/THOC4 and the NXF1-NXT1 heterodimer. Beyond its role in mRNA export, DDX39B is involved in transcription elongation and contributes to genome stability. Functioning as a splice factor, it is essential for the initial ATP-dependent step in spliceosome assembly and the interaction of U2 snRNP with the branchpoint. DDX39B exhibits RNA-stimulated ATP binding/hydrolysis activity and ATP-dependent RNA unwinding activity, with a preference for ssRNA over dsRNA. Notably, its ATPase and helicase activities remain largely unaffected by U2AF2, while the impact of ALYREF/THOC4 stimulation is reported with conflicting findings.

Species

Human

Source

E. coli

Tag

N-GST

Accession

Q13838 (A2-V251)

Gene ID
Molecular Construction
N-term
GST
DDX39B (A2-V251)
Accession # Q13838
C-term
Protein Length

Partial

Synonyms
0610030D10Rik; 4F2-LC6; 56kDa U2AF65-associated protein; AI428441; ATP-dependent RNA helicase p47; B(0,+)-type amino acid transporter 1; BAT1; Bat1a; D17H6S81E; D17H6S81E-1; D6S81E; D6S81Eh; DDX39B; DEAD (Asp-Glu-Ala-Asp) box polypeptide 39B; DEAD box protein UAP56; DX39B_HUMAN; EC 3.6.1.-; Glycoprotein-associated amino acid transporter b0,+AT1; HLA-B-associated transcript 1 protein; HLA-B-associated transcript 1A; HLA-B-associated transcript-1; MGC127051; MGC19235; MGC38799; nuclear RNA helicase (DEAD family); OTTHUMP00000029229; OTTHUMP00000165889; OTTHUMP00000165890; p47; Solute carrier family 7 member 9; Spliceosome RNA helicase BAT1; Spliceosome RNA helicase DDX39B; U2AF65-associayed protein; 56-KD; UAP56
AA Sequence

AENDVDNELLDYEDDEVETAAGGDGAEAPAKKDVKGSYVSIHSSGFRDFLLKPELLRAIVDCGFEHPSEVQHECIPQAILGMDVLCQAKSGMGKTAVFVLATLQQLEPVTGQVSVLVMCHTRELAFQISKEYERFSKYMPNVKVAVFFGGLSIKKDEEVLKKNCPHIVVGTPGRILALARNKSLNLKHIKHFILDECDKMLEQLDMRRDVQEIFRMTPHEKQVMMFSATLSKEIRPVCRKFMQDPMEIFV

Predicted Molecular Mass
55.2 kDa
Purity

≥ 90%, as determined by reducing SDS-PAGE.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Documentation

DDX39B Protein, Human (GST) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

DDX39B Protein, Human (GST)

 

Requested Quantity *

Applicant Name *

 

Salutation

Email Address *

 

Phone Number *

Department

 

Organization Name *

City

State

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
DDX39B Protein, Human (GST)
Cat. No.:
HY-P71534
Quantity:
MCE Japan Authorized Agent: