DDX39B Protein, Human (GST)
The DDX39B protein intricately coordinates nuclear mRNA export and is specifically associated with spliced mRNA as a key component of the TREX complex. This coupling of mRNA transcription, processing, and export involves rounds of ATP-dependent hydrolysis, recruiting components such as ALYREF/THOC and CHTOP. DDX39B Protein, Human (GST) is the recombinant human-derived DDX39B protein, expressed by E. coli , with N-GST labeled tag.
- Species: Human
- Source: E. coli
-
Storage:Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Biological Activity
Description
The DDX39B protein intricately coordinates nuclear mRNA export and is specifically associated with spliced mRNA as a key component of the TREX complex. This coupling of mRNA transcription, processing, and export involves rounds of ATP-dependent hydrolysis, recruiting components such as ALYREF/THOC and CHTOP. DDX39B Protein, Human (GST) is the recombinant human-derived DDX39B protein, expressed by E. coli , with N-GST labeled tag.
Background
The DDX39B protein is intricately involved in the nuclear export of both spliced and unspliced mRNA. As a crucial component of the TREX complex, it plays a pivotal role in coupling mRNA transcription, processing, and nuclear export, specifically associating with spliced mRNA rather than unspliced pre-mRNA. TREX is recruited to spliced mRNAs through a transcription-independent mechanism, binding to mRNA upstream of the exon-junction complex (EJC) and participating in mRNA export to the cytoplasm through the TAP/NFX1 pathway. During the assembly of TREX, DDX39B may undergo multiple rounds of ATP hydrolysis, driving the subsequent loading of components such as ALYREF/THOC and CHTOP onto mRNA. Additionally, DDX39B is implicated in the nuclear export of intronless mRNA, where its ATP-bound form recruits the export adapter ALYREF/THOC4 to intronless mRNA, with ATP hydrolysis triggering dissociation from RNA, allowing the association of ALYREF/THOC4 and the NXF1-NXT1 heterodimer. Beyond its role in mRNA export, DDX39B is involved in transcription elongation and contributes to genome stability. Functioning as a splice factor, it is essential for the initial ATP-dependent step in spliceosome assembly and the interaction of U2 snRNP with the branchpoint. DDX39B exhibits RNA-stimulated ATP binding/hydrolysis activity and ATP-dependent RNA unwinding activity, with a preference for ssRNA over dsRNA. Notably, its ATPase and helicase activities remain largely unaffected by U2AF2, while the impact of ALYREF/THOC4 stimulation is reported with conflicting findings.
Technical Parameters
-
Species Human
-
Source E. coli
-
Tag N-GST
-
Accession
Q13838 (A2-V251)
-
Molecular Construction
-
N-term
-
GST
-
DDX39B (A2-V251)
Accession # Q13838 -
C-term
-
-
Protein Length
Partial
-
Synonyms
DDX39B; DEAD-Box Helicase 39B; Prev. BAT1; HLA-B Associated Transcript 1; D6S81E; Spliceosome RNA Helicase BAT1; Uap56; U2AF65-Associated Protein 56; DEAD (Asp-Glu-Ala-Asp) Box Polypeptide 39B; ATP-Dependent RNA Helicase; HLA-B-Associated Transcript 1 Pro
-
AA Sequence
AENDVDNELLDYEDDEVETAAGGDGAEAPAKKDVKGSYVSIHSSGFRDFLLKPELLRAIVDCGFEHPSEVQHECIPQAILGMDVLCQAKSGMGKTAVFVLATLQQLEPVTGQVSVLVMCHTRELAFQISKEYERFSKYMPNVKVAVFFGGLSIKKDEEVLKKNCPHIVVGTPGRILALARNKSLNLKHIKHFILDECDKMLEQLDMRRDVQEIFRMTPHEKQVMMFSATLSKEIRPVCRKFMQDPMEIFV
-
Predicted Molecular Mass
55.2 kDa
-
Purity
≥ 90%, as determined by reducing SDS-PAGE.
Product Properties
Lyophilized powder.
<1 EU/μg, determined by LAL method.
It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O.
Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Room temperature in continental US; may vary elsewhere.
Documentation
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)