Doublecortin/DCX Protein, Human (His)

Doublecortin/DCX Protein, a microtubule-associated protein, is vital for early stages of neuronal dispersion and cortex lamination during cerebral cortex development. It may compete with the neuronal protein kinase DCLK1 in binding to a target protein, contributing to crucial signaling pathways involved in neuronal interaction and migration. DCX interacts with tubulin and USP9X. Doublecortin/DCX Protein, Human (His) is the recombinant human-derived Doublecortin/DCX protein, expressed by E. coli , with N-GST labeled tag. The total length of Doublecortin/DCX Protein, Human (His) is 106 a.a., with molecular weight of ~13 kDa.

The Doublecortin/DCX Protein plays a pivotal role as a microtubule-associated protein in the early stages of neuronal dispersion and cortex lamination during cerebral cortex development. Its function may involve competing with the putative neuronal protein kinase DCLK1 for binding to a target protein, thereby participating in a crucial signaling pathway essential for neuronal interaction before and during migration. This process is likely part of a calcium ion-dependent signal transduction pathway. Doublecortin/DCX may also collaborate with PAFAH1B1/LIS-1, contributing to overlapping yet distinct signaling pathways that collectively promote efficient neuronal migration. In this intricate cellular orchestration, Doublecortin/DCX interacts with tubulin and USP9X, emphasizing its involvement in the regulation of microtubule dynamics and highlighting its significance in the complex molecular pathways governing neuronal development.

Human

E. coli

N-6*His

O43602-2 (A45-V150)

1641  [NCBI]

ALSNEKKAKKVRFYRNGDRYFKGIVYAVSSDRFRSFDALLADLTRSLSDNINLPQGVRYIYTIDGSRKIGSMDELEEGESYVCSSDNFFKKVEYTKNVNPNWSVNV

Approximately 13 kDa

Greater than 82% as determined by reducing SDS-PAGE

Lyophilized powder.

Lyophilized from a 0.22 μm filtered solution of 50 mM Tris-HCL, 300 mM NaCl, pH 7.4.

<1 EU/μg, determined by LAL method.

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH₂O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Stored at -20°C for 2 years. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Room temperature in continental US; may vary elsewhere.