Doublecortin/DCX Protein, Human (His)
Based on 1 Customer Validation
Doublecortin/DCX Protein, a microtubule-associated protein, is vital for early stages of neuronal dispersion and cortex lamination during cerebral cortex development. It may compete with the neuronal protein kinase DCLK1 in binding to a target protein, contributing to crucial signaling pathways involved in neuronal interaction and migration. DCX interacts with tubulin and USP9X. Doublecortin/DCX Protein, Human (His) is the recombinant human-derived Doublecortin/DCX protein, expressed by E. coli , with N-GST labeled tag.
- Species: Human
- Source: E. coli
-
Storage:Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
To place orders, for customer services and technical support, please contact: MedChemExpress USA
Tel: 609-228-6898 E-mail: [email protected] [email protected]
-
Biological Activity
-
Technical Parameters
-
Product Properties
- Documentation
- Help & FAQs
Biological Activity
Description
Doublecortin/DCX Protein, a microtubule-associated protein, is vital for early stages of neuronal dispersion and cortex lamination during cerebral cortex development. It may compete with the neuronal protein kinase DCLK1 in binding to a target protein, contributing to crucial signaling pathways involved in neuronal interaction and migration. DCX interacts with tubulin and USP9X. Doublecortin/DCX Protein, Human (His) is the recombinant human-derived Doublecortin/DCX protein, expressed by E. coli , with N-GST labeled tag.
Background
The Doublecortin/DCX Protein plays a pivotal role as a microtubule-associated protein in the early stages of neuronal dispersion and cortex lamination during cerebral cortex development. Its function may involve competing with the putative neuronal protein kinase DCLK1 for binding to a target protein, thereby participating in a crucial signaling pathway essential for neuronal interaction before and during migration. This process is likely part of a calcium ion-dependent signal transduction pathway. Doublecortin/DCX may also collaborate with PAFAH1B1/LIS-1, contributing to overlapping yet distinct signaling pathways that collectively promote efficient neuronal migration. In this intricate cellular orchestration, Doublecortin/DCX interacts with tubulin and USP9X, emphasizing its involvement in the regulation of microtubule dynamics and highlighting its significance in the complex molecular pathways governing neuronal development.
MCE Validation Data
-
Purity - SDS-PAGE
Purity - SDS-PAGE
Technical Parameters
-
Species Human
-
Source E. coli
-
Tag N-6*His
-
Accession
O43602-2 (A45-V150)
-
Molecular Construction
-
N-term
-
GST
-
DCX (A45-V150)
Accession # O43602-2 -
C-term
-
-
Protein Length
Partial
-
Synonyms
DCX; Neuronal Migration Protein Doublecortin; Doublecortin; Lissencephalin-X; LISX; Doublecortex; DBCN; Doublin; SCLH; Lis-X; XLIS; Doublecortex; Lissencephaly, X-Linked (Doublecortin); DC
-
AA Sequence
ALSNEKKAKKVRFYRNGDRYFKGIVYAVSSDRFRSFDALLADLTRSLSDNINLPQGVRYIYTIDGSRKIGSMDELEEGESYVCSSDNFFKKVEYTKNVNPNWSVNV
-
Predicted Molecular Mass
12.2 kDa
-
Molecular Weight
Approximately 13 kDa, based on SDS-PAGE under reducing conditions.
-
Purity
≥ 80%, as determined by reducing SDS-PAGE.
Product Properties
Lyophilized powder.
Lyophilized from a 0.22 μm filtered solution of 50 mM Tris-HCl, 300 mM NaCl, pH 7.4.
Note: For SPR assay, please replace the buffer. Primary amine components (e.g., Tris, imidazole) can affect protein-coupled chips.
<1 EU/μg, determined by LAL method.
It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).
Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Room temperature in continental US; may vary elsewhere.
Documentation
-
Data Sheet (235 KB)
-
SDS (251 KB)
- English - EN (251 KB)
- Français - FR (251 KB)
- Deutsch - DE (251 KB)
- Norwegian - NO (251 KB)
- Español - ES (251 KB)
- Swedish - SV (251 KB)
- Italian - IT (251 KB)
- Korean - KR (251 KB)
- Portuguese - PT (251 KB)
-
Handling Instructions (2659 KB)
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
Powered by Bioz
