1. Recombinant Proteins
  2. Cytokines and Growth Factors Receptor Proteins
  3. TNF Superfamily Cytokine Receptors
  4. TNF Receptor Superfamily
  5. Death Receptor 3
  6. DR3/TNFRSF25 Protein, Human (HEK293, Fc)

DR3/TNFRSF25 Protein, the receptor for TNFSF12/APO3L/TWEAK, interacts with adapter TRADD, activating NF-kappa-B and inducing apoptosis. It may crucially regulate lymphocyte homeostasis. Forming homodimers, it strongly interacts with TNFRSF1 and TRADD via death domains, initiating distinct apoptosis and NF-kappa-B signaling cascades. Interaction with BAG4 contributes to its multifaceted cellular response roles. DR3/TNFRSF25 Protein, Human (HEK293, Fc) is the recombinant human-derived DR3/TNFRSF25 protein, expressed by HEK293 , with C-hFc labeled tag.

Para uso exclusivo en investigación. No vendemos a pacientes.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Tamaño Precio Stock
100 μg Pide un presupuesto y un plazo de entrega

* Seleccione Cantidad antes de agregar artículos.

Top Publications Citing Use of Products
  • Actividad biológica

  • Technical Parameters

  • Properties

  • Descripciòn

Descripciòn

DR3/TNFRSF25 Protein, the receptor for TNFSF12/APO3L/TWEAK, interacts with adapter TRADD, activating NF-kappa-B and inducing apoptosis. It may crucially regulate lymphocyte homeostasis. Forming homodimers, it strongly interacts with TNFRSF1 and TRADD via death domains, initiating distinct apoptosis and NF-kappa-B signaling cascades. Interaction with BAG4 contributes to its multifaceted cellular response roles. DR3/TNFRSF25 Protein, Human (HEK293, Fc) is the recombinant human-derived DR3/TNFRSF25 protein, expressed by HEK293 , with C-hFc labeled tag.

Background

DR3/TNFRSF25 Protein serves as the receptor for TNFSF12/APO3L/TWEAK and directly interacts with the adapter TRADD. This interaction leads to the activation of NF-kappa-B and induction of apoptosis. The protein may play a crucial role in regulating lymphocyte homeostasis. It forms homodimers and exhibits strong interactions via the death domains with TNFRSF1 and TRADD, initiating distinct signaling cascades involved in apoptosis and NF-kappa-B signaling. Additionally, DR3/TNFRSF25 interacts with BAG4, contributing to its multifaceted roles in cellular responses.

Species

Human

Source

HEK293

Tag

C-hFc

Accession

Q93038 (Q25-Q199)

Gene ID
Molecular Construction
N-term
DR3 (Q25-Q199)
Accession # Q93038
hFc
C-term
Protein Length

Partial

Synonyms
Tumor necrosis factor receptor superfamily member 25; Apo-3; LARD; TNFRSF25; DR3; TNFRSF12; WSL; WSL1
AA Sequence

QGGTRSPRCDCAGDFHKKIGLFCCRGCPAGHYLKAPCTEPCGNSTCLVCPQDTFLAWENHHNSECARCQACDEQASQVALENCSAVADTRCGCKPGWFVECQVSQCVSSSPFYCQPCLDCGALHRHTRLLCSRRDTDCGTCLPGFYEHGDGCVSCPTSTLGSCPERCAAVCGWRQ

Predicted Molecular Mass
45.9 kDa
Peso molecular

Approximately 50-63 kDa, based on SDS-PAGE under reducing conditions, due to the glycosylation.

Glycosylation
Yes
Pureza

≥ 95%, as determined by reducing SDS-PAGE.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Documentación
Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Productos vistos recientemente:

Consulta en línea

Your information is safe with us. * Required Fields.

DR3/TNFRSF25 Protein, Human (HEK293, Fc)

 

Requested Quantity *

Nombre del solicitante *

 

Saludo

Direcciòn del E-mail *

 

Número de teléfono *

Department

 

Nombre de la Organizaciòn *

City

Provincia

Country or Region *

     

Observaciones

Consulta para venta a granel

Inquiry Information

Nombre del producto:
DR3/TNFRSF25 Protein, Human (HEK293, Fc)
Cat. No.:
HY-P72666
Cantidad:
MCE Japan Authorized Agent: