DR6/TNFRSF21 Protein, Rat (HEK293, Fc)

DR6/TNFRSF21 protein is the core of apoptosis and may activate NF-kappa-B and promote BAX-mediated apoptosis through cytochrome c release. In neuronal apoptosis, it responds to amyloid peptides in APP, which is critical for cell body death and axonal pruning. DR6/TNFRSF21 Protein, Rat (HEK293, Fc) is the recombinant rat-derived DR6/TNFRSF21 protein, expressed by HEK293 , with C-hFc labeled tag. The total length of DR6/TNFRSF21 Protein, Rat (HEK293, Fc) is 349 a.a., with molecular weight of ~95-115 kDa.

DR6/TNFRSF21 protein plays a pivotal role in promoting apoptosis, potentially through a pathway involving the activation of NF-kappa-B. It can also facilitate apoptosis mediated by BAX and the release of cytochrome c from mitochondria into the cytoplasm. This protein is actively involved in neuronal apoptosis, responding to amyloid peptides derived from APP, and is crucial for normal cell body death and axonal pruning. Trophic-factor deprivation triggers the cleavage of surface APP by beta-secretase, releasing sAPP-beta, which binds TNFRSF21, subsequently activating caspases and inducing degeneration of both neuronal cell bodies (via caspase-3) and axons (via caspase-6). In addition to its role in neuronal processes, DR6/TNFRSF21 negatively regulates oligodendrocyte survival, maturation, and myelination. Furthermore, it plays a role in T-cell receptor-mediated signaling, adaptive immune responses, and the regulation of T-cell differentiation and proliferation, exhibiting negative regulatory effects on cytokine release and antibody production. Additionally, DR6/TNFRSF21 acts as a regulator of pyroptosis by recruiting CASP8 in response to reactive oxygen species, leading to the activation of GSDMC. It interacts with TRADD, NGFR, CASP8, and N-APP in the intricate network of its molecular functions.

Measured by its binding ability in a functional ELISA. When Recombinant Human APP Protein is immobilized at 2 µg/mL (100 µL/well) can bind Recombinant Rat DR6/TNFRSF21 Protein. The ED₅₀ for this effect is 98.85 ng/mL.

Rat

HEK293

C-hFc

D3ZF92 (Q42-H349)

316256  [NCBI]

QPEQKTLSLTGTYRHVDRTTGQVLTCDKCPAGTYVSEHCTNTSLRVCSSCPSGTFTRHENGIERCHDCSQPCPRPMIERLPCAALTDRECICPPGMYQSNGTCAPHTVCPVGWGVRKKGTENEDVRCKQCARGTFSDVPSSVMKCRAHTDCLGQNLMVVKQGTKETDNVCGVHLSSSSTTPSSPGIATFSHPEHTESHDVPSSTYEPQGMNSTDSNSTASVRTKVPSDIQEETVPDNTSSTSGKESTNRTLPNPPQLTHQQGPHHRHILKLLPSSMEATGEKSSTAIKAPKRGHPRQNPHKHFDINEH

Approximately 95-115 kDa due to the glycosylation

Greater than 95% as determined by reducing SDS-PAGE

Lyophilized powder.

Lyophilized from a 0.2 μm filtered solution of PBS, pH 7.4.

<1 EU/μg, determined by LAL method.

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH₂O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Stored at -20°C for 2 years. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Room temperature in continental US; may vary elsewhere.