1. Recombinant Proteins
  2. Viral Proteins
  3. Dengue Virus Proteins
  4. DENV E Proteins
  5. E/Envelope Protein, Dengue virus 1 (101a.a, sf9, His)

E/Envelope Protein, Dengue virus 1 (101a.a, sf9, His)

Cat. No.: HY-P74197
Handling Instructions Technical Support

The NS1 protein plays a key role in viral budding, association with cell membranes, and facilitating the assembly of viral RNA into nucleocapsids to form mature viral particles.During entry, NS1 induces genome penetration into the host cytoplasm.E/Envelope Protein, Dengue virus 1 (101a.a, sf9, His) is the recombinant Virus-derived E/Envelope protein, expressed by Sf9 insect cells , with C-His labeled tag.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Stock
50 μg   Get quote  
100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

The NS1 protein plays a key role in viral budding, association with cell membranes, and facilitating the assembly of viral RNA into nucleocapsids to form mature viral particles.During entry, NS1 induces genome penetration into the host cytoplasm.E/Envelope Protein, Dengue virus 1 (101a.a, sf9, His) is the recombinant Virus-derived E/Envelope protein, expressed by Sf9 insect cells , with C-His labeled tag.

Background

The NS1 protein assumes a pivotal role in virus budding by binding to the cell membrane, facilitating the assembly of the viral RNA into a nucleocapsid that forms the core of a mature virus particle. During virus entry, NS1 may induce genome penetration into the host cytoplasm following hemifusion induced by surface proteins. Notably, NS1 exhibits the ability to migrate to the cell nucleus, where it modulates host functions. Additionally, NS1 counteracts the antiviral effects of host EXOC1 by sequestering and degrading EXOC1 through the proteasome degradation pathway. Furthermore, NS1 disrupts RNA silencing by interfering with host Dicer, highlighting its multifaceted role in manipulating both viral and host cellular processes throughout the infection cycle.

Species

Virus

Source

Sf9 insect cells

Tag

C-His

Accession

ACF49259 (V580-K680)

Gene ID

/

Molecular Construction
N-term
DENV1 E (V580-K680)
Accession # ACF49259
His
C-term
Protein Length

Partial

Synonyms
E Protein; DENV; Envelope; Dengue virus (DENV) (type 1, strain US/Hawaii/1944) E/Envelope Protein Domain III
AA Sequence

VMCTGSFKLEKEVAETQHGTVLVQVKYEGTDAPCKIPFSTQDEKGVTQNGRLITANPIVTDKEKPVNIEAEPPFGESYIVVGAGEKALKLSWFKKGSSIGK

Predicted Molecular Mass
12.4 kDa
Purity

≥ 95%, as determined by reducing SDS-PAGE.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Documentation

E/Envelope Protein, Dengue virus 1 (101a.a, sf9, His) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

E/Envelope Protein, Dengue virus 1 (101a.a, sf9, His)

 

Requested Quantity *

Applicant Name *

 

Salutation

Email Address *

 

Phone Number *

Department

 

Organization Name *

City

State

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
E/Envelope Protein, Dengue virus 1 (101a.a, sf9, His)
Cat. No.:
HY-P74197
Quantity:
MCE Japan Authorized Agent: