E/Envelope Protein, West Nile Virus Lineage 1 (109a.a, P.pastoris, His)

E/Envelope Protein, West Nile Virus Lineage 1 (109a.a, P.pastoris, His) is the recombinant Virus-derived E/Envelope protein, expressed by P. pastoris, with C-His labeled tag.

E/Envelope acts as a chaperone for the envelope protein E during intracellular virion assembly by masking and inactivating the fusion peptide of envelope protein E. prM is the only viral peptide matured by host furin in the trans-Golgi network, likely to prevent catastrophic activation of viral fusion activity in the acidic Golgi compartment prior to virion release. prM-E cleavage is inefficient, resulting in many virions being only partially matured. These uncleaved prM may play a role in immune evasion. by similar: These uncleaved prM may play a role in immune evasion.

Virus

P. pastoris

C-His

ABA62343.1 (Q586-I694)

5714902  [NCBI]

Partial

QLKGTTYGVCSKAFKFLGTPADTGHGTVVLELQYTGTDGPCKVPISSVASLNDLTPVGRLVTVNPFVSVATANAKVLIELEPPFGDSYIVVGRGEQQINHHWHKSGSSI

≥ 95%, as determined by reducing SDS-PAGE.

<1 EU/μg, determined by LAL method.