Copy Link Print Information

E-selectin/CD62E Protein, Cynomolgus (HEK293, His)

Customer Review

Based on 1 Customer Validation

The E-selectin/CD62E protein belongs to the selectin/LECAM family and plays a crucial role in mediating cell adhesion processes, particularly the interaction between leukocytes and endothelial cells. As a member of this family, E-selectin may have conserved characteristics, underscoring its importance in cell adhesion. E-selectin/CD62E Protein, Cynomolgus (HEK293, His) is the recombinant cynomolgus-derived E-selectin/CD62E protein, expressed by HEK293 , with C-His labeled tag.

For research use only. We do not sell to patients.
  • Species: Cynomolgus
  • Source: HEK293
  • Storage:
    Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
  • Experimental Validation Results for E-selectin/CD62E Protein, Cynomolgus (HEK293, His)
  • Experimental Validation Results for E-selectin/CD62E Protein, Cynomolgus (HEK293, His)
  • E-selectin/CD62E Protein, Cynomolgus (HEK293, His) Product Image
Size
Price
Stock
Quantity
Amount: USD 0.00
Please select quantity
or
or

* Please select Quantity before adding items.

To place orders, for customer services and technical support, please contact: MedChemExpress USA

Tel: 609-228-6898 E-mail: [email protected] [email protected]

Service
Data Download

To place orders, for customer services and technical support, please contact:

609-228-6898
[email protected] [email protected]
Find Your Local Distributor Your local distributor: Hycultec GmbHHycultec
  • Biological Activity
  • Technical Parameters
  • Product Properties
  • Documentation
  • Help & FAQs
Top Publications Citing

Use of MCE Products

Biological Activity

Description

The E-selectin/CD62E protein belongs to the selectin/LECAM family and plays a crucial role in mediating cell adhesion processes, particularly the interaction between leukocytes and endothelial cells. As a member of this family, E-selectin may have conserved characteristics, underscoring its importance in cell adhesion. E-selectin/CD62E Protein, Cynomolgus (HEK293, His) is the recombinant cynomolgus-derived E-selectin/CD62E protein, expressed by HEK293 , with C-His labeled tag.

Background

The E-selectin/CD62E Protein is a vital member of the selectin/LECAM family, signifying its significant role in cell adhesion processes. As part of this family, E-selectin likely shares conserved structural and functional features with related proteins, indicating its involvement in mediating interactions between leukocytes and endothelial cells. The classification within the selectin/LECAM family underscores its specific designation within the broader context of cell adhesion molecules, providing insights into its unique contributions to cellular adhesion. The study of E-selectin/CD62E contributes to our understanding of its role in inflammatory responses and immune cell trafficking, offering potential applications in therapeutic interventions and a deeper comprehension of its broader impact on cellular processes involved in immune surveillance and inflammation. Further exploration of E-selectin/CD62E's role holds promise for enhancing our knowledge of its contributions to normal physiology and pathological conditions.

Verified Bioactivity

Measured by the ability of the immobilized protein to support the adhesion of U937 human histiocytic lymphoma cells. The ED50 for this effect is 29.560 ng/mL, corresponding to a specific activity is 3.392×104 units/mg.

MCE Validation Data

  • Purity - SDS-PAGE

    Purity - SDS-PAGE

    ≥ 95%, as determined by reducing SDS-PAGE.

  • Bioactivity - Cell-Based Assay

    Bioactivity - Cell-Based Assay

    Measured by the ability of the immobilized protein to support the adhesion of U937 human histiocytic lymphoma cells. The ED50 for this effect is 29.560 ng/mL, corresponding to a specific activity is 3.392×104 units/mg.

Technical Parameters

  • Species Cynomolgus
  • Source HEK293
  • Tag C-His
  • Accession

    G8F370 (W22-P556)

  • Gene ID
    /
  • Molecular Construction
    • N-term
    • CD62E (W22-P556)
      Accession # G8F370
    • His
    • C-term
  • Protein Length

    Partial

  • Synonyms

    SELE; ESEL; Prev. ELAM1; Endothelial Adhesion Molecule 1; Prev. ELAM; ELAM-1; Endothelial Leukocyte Adhesion Molecule 1; LECAM2; CD62 Antigen-Like Family Member E; Leukocyte Endothelial Cell Adhesion Molecule 2; E-Selectin; CD62E Antigen; CD62E; Selectin-

  • AA Sequence

    WSYNTSTEAMTYDEASAYCQQRYTHLVAIQNKEEIEYLNSILSYSPSYYWIGIRKVNNVWVWVGTQKPLTEEAKNWAPGEPNNRQKDEDCVEIYIKRDKDVGMWNDERCSKKKLALCYTAACTNTSCSGHGECVETINNYTCKCDPGFSGLECEQIVNCTALESPEHGSLVCSHPLGNFSYSSSCSVSCDRGYLPSSVETTQCMSSGEWSVPIPACKVVECDAVTNPANGFVECFQNPGSFPWNTTCTFDCEEGFELMGAQSLQCTSSGNWDNEKPTCKAVTCRAIRQPQNGSVRCSHSPAGEFTFKSSCNFTCEEGFMLQGAAQVECTTQGQWTQQVPVCEAFQCTALSNPERGYMNCLPSASGSFRNGSSCEFSCEQGFVLKGSKRLQCGPTGEWDNEKPTCEAVRCDAVHQPQRGLVRCAHSPIGEFTYKSSCAFSCEEGFELHGSTQLECTSQGQWTEEVPSCQVVKCSSLAVLEKINMSCSGEPVFGTVCNFACPEGWRLNGSAAMTCGATGHWSGMLPTCEAPTESNTP

  • Molecular Weight

    Approximately 90-100 kDa, based on SDS-PAGE under reducing conditions.

  • Purity

    ≥ 95%, as determined by reducing SDS-PAGE.

Product Properties

Appearance

Lyophilized powder

Formulation

Lyophilized from a 0.2 μm filtered solution of PBS, pH 7.4. Normally 5 % - 8 % trehalose, mannitol and 0.01% Tween 80 are added as protectants before lyophilization.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O.

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Calculators

Reconstitution Calculator

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) Volume (to add to vial)
=
Mass (in vial) Mass (in vial)
÷
Desired Reconstitution Concentration Desired Reconstitution Concentration
Dilution Calculator

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

Concentration (start) Concentration (start)
×
Volume (start) Volume (start)
=
Concentration (final) Concentration (final)
×
Volume (final) Volume (final)
The Specific Activity Calculator Equation
  • Specific Activity (Unit/mg)
  • Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) Specific Activity (Unit/mg)
Unit/mg
= 106 ÷
Biological Activity (ED50) Biological Activity (ED50)
106 ÷
ng/mL
MOQ
Minimum order quantity
100 mg

Get Quote In-stock

Other size
Get Quote
Please select quantity
Amount: USD 0.00

Measured by its ability to inhibit anti-CD3-induced proliferation of stimulated CTLL-2 mouse cytotoxic T cells. The ED50 this effect is 0.8023 μg/ml, corresponding to a specific activity is 1246.42 units/mg.

Assay Types
  • 1/16

    MedChemExpress Validation
     ≥ 95%, as determined by reducing SDS-PAGE.

  • 1/16

    MedChemExpress Validation
     Measured by the ability of the immobilized protein to support the adhesion of U937 human histiocytic lymphoma cells. The ED50 for this effect is 29.560 ng/mL, corresponding to a specific activity is 3.392×104 units/mg.

  • E-selectin/CD62E Protein, Cynomolgus (HEK293, His) Product Image
    1/16
  • Experimental Validation Results for E-selectin/CD62E Protein, Cynomolgus (HEK293, His)
  • Experimental Validation Results for E-selectin/CD62E Protein, Cynomolgus (HEK293, His)
  • E-selectin/CD62E Protein, Cynomolgus (HEK293, His) Product Image