2. Recombinant Proteins
  3. CD Antigens Receptor Proteins
  4. Endothelial cell CD Proteins Cell Adhesion Molecules (CAMs)
  5. E-Selectin/CD62E Selectin
  6. E-Selectin
  7. E-Selectin/CD62E Protein, Rat (HEK293, Fc)

E-Selectin/CD62E Protein, Rat (HEK293, Fc)

Cat. No.: HY-P73043
Handling Instructions

The E-selectin/CD62E protein is a cell surface glycoprotein that critically mediates immune adhesion by promoting neutrophil adhesion to cytokine-activated endothelial cells through the SELPLG/PSGL1 interaction. It may also contribute to capillary morphogenesis and interact with SELPLG/PSGL1 and PODXL2 via the sialyl Lewis X epitope regardless of SELPLG sulfation. E-Selectin/CD62E Protein, Rat (HEK293, Fc) is the recombinant rat-derived E-Selectin/CD62E protein, expressed by HEK293 , with C-hFc labeled tag. The total length of E-Selectin/CD62E Protein, Rat (HEK293, Fc) is 473 a.a., with molecular weight of 114-119 kDa.

For research use only. We do not sell to patients.

Protein Expression Service

Size Stock
50 μg   Get quote  
100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products

  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

The E-selectin/CD62E protein is a cell surface glycoprotein that critically mediates immune adhesion by promoting neutrophil adhesion to cytokine-activated endothelial cells through the SELPLG/PSGL1 interaction. It may also contribute to capillary morphogenesis and interact with SELPLG/PSGL1 and PODXL2 via the sialyl Lewis X epitope regardless of SELPLG sulfation. E-Selectin/CD62E Protein, Rat (HEK293, Fc) is the recombinant rat-derived E-Selectin/CD62E protein, expressed by HEK293 , with C-hFc labeled tag. The total length of E-Selectin/CD62E Protein, Rat (HEK293, Fc) is 473 a.a., with molecular weight of 114-119 kDa.
Background

E-Selectin/CD62E protein, a cell-surface glycoprotein, plays a pivotal role in immunoadhesion by mediating the adhesion of blood neutrophils to cytokine-activated endothelium through interaction with SELPLG/PSGL1. Beyond its immunological function, E-Selectin may contribute to capillary morphogenesis. The protein engages in interactions with SELPLG/PSGL1 and PODXL2 through the sialyl Lewis X epitope, with the noteworthy observation that SELPLG sulfation seems dispensable for this interaction. These findings underscore the diverse roles of E-Selectin in facilitating cellular adhesion events and suggest its potential involvement in processes related to vascular development.
Species

Rat
Source

HEK293
Tag

C-hFc
Accession

P98105 (W22-P494)
Gene ID

25544  [NCBI]
Molecular Construction
N-term
CD62E (W22-P494)
Accession # P98105
hFc
C-term
Synonyms
E-selectin; ELAM-1; LECAM2; CD62E; SELE
AA Sequence

MNASCFLSALTFVLLIGKSIAWYYNASSELMTYDEASAYCQRDYTHLVAIQNKEEINYLNSTLRYSPSYYWIGIRKVNNVWIWVGTQKPLTEEAKNWAPGEPNNKQRNEDCVEIYIQRPKDSGMWNDERCDKKKLALCYTASCTNTSCSGHGECVETINSYTCKCHPGFLGPKCDQVVTCQEQEYPDHGSLNCTHPFGLFSYNSSCSFSCERGYVPSSMETTVRCTSSGEWSAPAPACHVVECKALTQPAHGVRKCSSNPGSYPWNTTCTFDCEEGYRRVGAQNLQCTSSGVWDNEKPSCKAVTCDAIPRPQNGSVSCSNSTAGALAFKSSCNFTCEHSFTLQGPAQVECSAQGQWTPQIPVCKASQCEALSAPQRGHMKCLPSASAPFQSGSSCKFSCDEGFELKGSRRLQCGPRGEWDSEKPTCAGVQCSSLDLPGKMNMSCSGPAVFGTVCEFTCPEGWTLNGSSILTCGATGRWSAMLPTCEAPANPPRP

Molecular Weight

114-119 kDa
Purity

Greater than 95% as determined by reducing SDS-PAGE
Endotoxin Level

<1 EU/μg, determined by LAL method.
Documentation
Handling Instructions (2659 KB)

E-Selectin/CD62E Protein, Rat (HEK293, Fc) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

  

Salutation

Applicant Name *

 

Email Address *

Phone Number *

 

Organization Name *

Department *

 

Requested quantity *

Country or Region *

      

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
E-Selectin/CD62E Protein, Rat (HEK293, Fc)
Cat. No.:
HY-P73043
Quantity:
MCE Japan Authorized Agent:

Request for HNMR Report

Please fill out this form to request the QC report. We will send it to your Email address shortly.

Your information is safe with us. * Required Fields.

Product Name

  

Lot #

Applicant Name *

 

Country or Region *

Email Address *

     

Phone Number *

 

Organization Name *

Remarks

Request for HNMR Report

We have received your request and will respond to you as soon as possible.