EB3/MAPRE3 Protein, Human (His)

The EB3/MAPRE3 protein is a plus-end tracking protein (+TIP) that dynamically regulates microtubule cytoskeletal dynamics by binding to the plus-end of microtubules. It promotes microtubule growth, stabilizes it at the centrosome, and regulates minus-end microtubule organization. EB3/MAPRE3 Protein, Human (His) is the recombinant human-derived EB3/MAPRE3 protein, expressed by E. coli , with N-His labeled tag. The total length of EB3/MAPRE3 Protein, Human (His) is 281 a.a., with molecular weight of ~34 kDa.

EB3, a plus-end tracking protein (+TIP), intricately modulates the dynamics of the microtubule cytoskeleton by binding to the plus-end of microtubules. Functionally, EB3 serves as a promoter of microtubule growth and potentially contributes to spindle function by stabilizing microtubules and anchoring them at centrosomes. Additionally, it acts as a crucial regulator of minus-end microtubule organization, participating in the recruitment of CAMSAP2 to the Golgi apparatus through interaction with the complex formed by AKAP9 and PDE4DIP. This interaction is pivotal for tethering non-centrosomal minus-end microtubules to the Golgi, a process essential for polarized cell movement. EB3 forms homodimers and heterodimers with MAPRE1, binding both monomeric and polymerized GTP-bound tubulin. Its intricate network of interactions includes APC2, DCTN1, SRCIN1, CLIP1, SLAIN2, SLAIN1, AKAP9, and PDE4DIP, underscoring its multifaceted role in microtubule dynamics and cellular organization.

Human

E. coli

N-6*His

Q9UPY8-1 (M1-Y281)

22924  [NCBI]

MAVNVYSTSVTSENLSRHDMLAWVNDSLHLNYTKIEQLCSGAAYCQFMDMLFPGCVHLRKVKFQAKLEHEYIHNFKVLQAAFKKMGVDKIIPVEKLVKGKFQDNFEFIQWFKKFFDANYDGKDYNPLLARQGQDVAPPPNPGDQIFNKSKKLIGTAVPQRTSPTGPKNMQTSGRLSNVAPPCILRKNPPSARNGGHETDAQILELNQQLVDLKLTVDGLEKERDFYFSKLRDIELICQEHESENSPVISGIIGILYATEEGFAPPEDDEIEEHQQEDQDEY

Approximately 34 kDa

• 
  Greater than 95% as determined by reducing SDS-PAGE.

Lyophilized powder

Lyophilized from a 0.2 μm filtered solution of PBS, pH 7.4.

<1 EU/μg, determined by LAL method.

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH₂O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Stored at -20°C for 2 years. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Room temperature in continental US; may vary elsewhere.