EB3/MAPRE3 Protein, Human (His)
Based on 1 Customer Validation
The EB3/MAPRE3 protein is a plus-end tracking protein (+TIP) that dynamically regulates microtubule cytoskeletal dynamics by binding to the plus-end of microtubules. It promotes microtubule growth, stabilizes it at the centrosome, and regulates minus-end microtubule organization. EB3/MAPRE3 Protein, Human (His) is the recombinant human-derived EB3/MAPRE3 protein, expressed by E. coli , with N-His labeled tag.
- Species: Human
- Source: E. coli
-
Storage:Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
To place orders, for customer services and technical support, please contact: MedChemExpress USA
Tel: 609-228-6898 E-mail: [email protected] [email protected]
-
Biological Activity
-
Technical Parameters
-
Product Properties
- Documentation
- Help & FAQs
Biological Activity
The EB3/MAPRE3 protein is a plus-end tracking protein (+TIP) that dynamically regulates microtubule cytoskeletal dynamics by binding to the plus-end of microtubules. It promotes microtubule growth, stabilizes it at the centrosome, and regulates minus-end microtubule organization. EB3/MAPRE3 Protein, Human (His) is the recombinant human-derived EB3/MAPRE3 protein, expressed by E. coli , with N-His labeled tag.
EB3, a plus-end tracking protein (+TIP), intricately modulates the dynamics of the microtubule cytoskeleton by binding to the plus-end of microtubules. Functionally, EB3 serves as a promoter of microtubule growth and potentially contributes to spindle function by stabilizing microtubules and anchoring them at centrosomes. Additionally, it acts as a crucial regulator of minus-end microtubule organization, participating in the recruitment of CAMSAP2 to the Golgi apparatus through interaction with the complex formed by AKAP9 and PDE4DIP. This interaction is pivotal for tethering non-centrosomal minus-end microtubules to the Golgi, a process essential for polarized cell movement. EB3 forms homodimers and heterodimers with MAPRE1, binding both monomeric and polymerized GTP-bound tubulin. Its intricate network of interactions includes APC2, DCTN1, SRCIN1, CLIP1, SLAIN2, SLAIN1, AKAP9, and PDE4DIP, underscoring its multifaceted role in microtubule dynamics and cellular organization.
Technical Parameters
-
Species Human
-
Source E. coli
-
Tag N-6*His
-
Accession
Q9UPY8-1 (M1-Y281)
-
Molecular Construction
-
N-term
-
His
-
EB3/MAPRE3 (M1-Y281)
Accession # Q9UPY8-1 -
C-term
-
-
Protein Length
Full Length of Isoform-1
-
Synonyms
MAPRE3; EB1 Protein Family Member 3; Microtubule Associated Protein RP/EB Family Member 3; End-Binding Protein 3; RP3; EBF3; EB3; APC Binding Protein; Microtubule-Associated Protein RP/EB Family Member 3; EBF3-S
-
AA Sequence
MAVNVYSTSVTSENLSRHDMLAWVNDSLHLNYTKIEQLCSGAAYCQFMDMLFPGCVHLRKVKFQAKLEHEYIHNFKVLQAAFKKMGVDKIIPVEKLVKGKFQDNFEFIQWFKKFFDANYDGKDYNPLLARQGQDVAPPPNPGDQIFNKSKKLIGTAVPQRTSPTGPKNMQTSGRLSNVAPPCILRKNPPSARNGGHETDAQILELNQQLVDLKLTVDGLEKERDFYFSKLRDIELICQEHESENSPVISGIIGILYATEEGFAPPEDDEIEEHQQEDQDEY
-
Molecular Weight
Approximately 34 kDa, based on SDS-PAGE under reducing conditions.
-
Purity
≥ 95%, as determined by reducing SDS-PAGE.
Product Properties
Lyophilized powder.
Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4.
<1 EU/μg, determined by LAL method.
It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).
Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Room temperature in continental US; may vary elsewhere.
Documentation
-
Data Sheet (237 KB)
-
SDS (251 KB)
- English - EN (251 KB)
- Français - FR (251 KB)
- Deutsch - DE (251 KB)
- Norwegian - NO (251 KB)
- Español - ES (251 KB)
- Swedish - SV (251 KB)
- Italian - IT (251 KB)
- Korean - KR (251 KB)
- Portuguese - PT (251 KB)
-
Handling Instructions (2659 KB)
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
Powered by Bioz
