EDAR Protein, Mouse (HEK293, Fc)
Based on 1 Customer Validation
EDAR protein is a receptor for the EDA isoform TAA, which, unlike TA-2, may activate the NF-kappa-B and JNK pathways, indicating its involvement in immune signaling. In addition, EDAR may cause caspase-independent cell death. EDAR Protein, Mouse (HEK293, Fc) is the recombinant mouse-derived EDAR protein, expressed by HEK293 , with C-hFc labeled tag.
- Species: Mouse
- Source: HEK293
-
Storage:Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
To place orders, for customer services and technical support, please contact: MedChemExpress USA
Tel: 609-228-6898 E-mail: [email protected] [email protected]
-
Biological Activity
-
Technical Parameters
-
Product Properties
- Documentation
- Help & FAQs
Biological Activity
Description
EDAR protein is a receptor for the EDA isoform TAA, which, unlike TA-2, may activate the NF-kappa-B and JNK pathways, indicating its involvement in immune signaling. In addition, EDAR may cause caspase-independent cell death. EDAR Protein, Mouse (HEK293, Fc) is the recombinant mouse-derived EDAR protein, expressed by HEK293 , with C-hFc labeled tag.
Background
EDAR Protein functions as a receptor specifically for EDA isoform TAA, distinguishing it from isoform TA-2. This receptor potentially mediates the activation of NF-kappa-B and JNK pathways, suggesting its involvement in signaling cascades associated with immune responses. Additionally, EDAR may play a role in promoting caspase-independent cell death. Its binding to EDARADD and association with key proteins such as TRAF1, TRAF2, TRAF3, and NIK underscore its role in complex signaling networks, emphasizing its significance in cellular processes beyond immune modulation, potentially contributing to cellular survival and programmed cell death mechanisms.
MCE Validation Data
-
Purity - SDS-PAGE
Purity - SDS-PAGE
Technical Parameters
-
Species Mouse
-
Source HEK293
-
Tag C-hFc
-
Accession
Q9R187 (E27-I189)
-
Molecular Construction
-
N-term
-
EDAR (E27-I189)
Accession # Q9R187 -
hFc
-
C-term
-
-
Protein Length
Extracellular Domain
-
Synonyms
EDAR; Ectodermal Dysplasia Receptor; Prev. DL; Downless Homolog; Prev. ED3; EDA-A1 Receptor; Tumor Necrosis Factor Receptor Superfamily Member EDAR; Hypohidrotic Ectodermal Dysplasia; EDA1R; Downless, Mouse, Homolog Of; EDA3; Ectodysplasin-A Receptor; ED1
-
AA Sequence
EDSNCGENEYHNQTTGLCQQCPPCRPGEEPYMSCGYGTKDDDYGCVPCPAEKFSKGGYQICRRHKDCEGFFRATVLTPGDMENDAECGPCLPGYYMLENRPRNIYGMVCYSCLLAPPNTKECVGATSGVSAHSSSTSGGSTLSPFQHAHKELSGQGHLATALI
-
Predicted Molecular Mass
44.7 kDa
-
Molecular Weight
Approximately 58-88 kDa, based on SDS-PAGE under reducing conditions.
-
Glycosylation
Yes
-
Purity
≥ 95%, as determined by reducing SDS-PAGE.
Product Properties
Lyophilized powder.
Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4.
<1 EU/μg, determined by LAL method.
It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).
Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Room temperature in continental US; may vary elsewhere.
Documentation
-
Data Sheet (236 KB)
-
SDS (252 KB)
- English - EN (252 KB)
- Français - FR (252 KB)
- Deutsch - DE (252 KB)
- Norwegian - NO (252 KB)
- Español - ES (252 KB)
- Swedish - SV (252 KB)
- Italian - IT (252 KB)
- Korean - KR (252 KB)
- Portuguese - PT (252 KB)
-
Handling Instructions (2659 KB)
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
Powered by Bioz
