EDAR Protein, Mouse (HEK293, Fc)

EDAR protein is a receptor for the EDA isoform TAA, which, unlike TA-2, may activate the NF-kappa-B and JNK pathways, indicating its involvement in immune signaling. In addition, EDAR may cause caspase-independent cell death. EDAR Protein, Mouse (HEK293, Fc) is the recombinant mouse-derived EDAR protein, expressed by HEK293 , with C-hFc labeled tag. The total length of EDAR Protein, Mouse (HEK293, Fc) is 163 a.a., with molecular weight of 58-74 kDa.

EDAR Protein functions as a receptor specifically for EDA isoform TAA, distinguishing it from isoform TA-2. This receptor potentially mediates the activation of NF-kappa-B and JNK pathways, suggesting its involvement in signaling cascades associated with immune responses. Additionally, EDAR may play a role in promoting caspase-independent cell death. Its binding to EDARADD and association with key proteins such as TRAF1, TRAF2, TRAF3, and NIK underscore its role in complex signaling networks, emphasizing its significance in cellular processes beyond immune modulation, potentially contributing to cellular survival and programmed cell death mechanisms.

Mouse

HEK293

C-hFc

Q9R187 (E27-I189)

13608  [NCBI]

EDSNCGENEYHNQTTGLCQQCPPCRPGEEPYMSCGYGTKDDDYGCVPCPAEKFSKGGYQICRRHKDCEGFFRATVLTPGDMENDAECGPCLPGYYMLENRPRNIYGMVCYSCLLAPPNTKECVGATSGVSAHSSSTSGGSTLSPFQHAHKELSGQGHLATALI

58-74 kDa

Greater than 95% as determined by reducing SDS-PAGE

Lyophilized powder.

Lyophilized from a 0.2 μm filtered solution of PBS, pH 7.4.

<1 EU/μg, determined by LAL method.

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH₂O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Stored at -20°C for 2 years. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Room temperature in continental US; may vary elsewhere.