1. Recombinant Proteins
  2. Cytokines and Growth Factors
  3. TNF Superfamily
  4. TNF Receptor Superfamily
  5. EDAR
  6. EDAR Protein, Mouse (HEK293, Fc)

EDAR Protein, Mouse (HEK293, Fc)

Cat. No.: HY-P70115
SDS COA Handling Instructions

EDAR protein is a receptor for the EDA isoform TAA, which, unlike TA-2, may activate the NF-kappa-B and JNK pathways, indicating its involvement in immune signaling. In addition, EDAR may cause caspase-independent cell death. EDAR Protein, Mouse (HEK293, Fc) is the recombinant mouse-derived EDAR protein, expressed by HEK293 , with C-hFc labeled tag. The total length of EDAR Protein, Mouse (HEK293, Fc) is 163 a.a., with molecular weight of 58-74 kDa.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Price Stock Quantity
10 μg In-stock
50 μg In-stock
100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

EDAR protein is a receptor for the EDA isoform TAA, which, unlike TA-2, may activate the NF-kappa-B and JNK pathways, indicating its involvement in immune signaling. In addition, EDAR may cause caspase-independent cell death. EDAR Protein, Mouse (HEK293, Fc) is the recombinant mouse-derived EDAR protein, expressed by HEK293 , with C-hFc labeled tag. The total length of EDAR Protein, Mouse (HEK293, Fc) is 163 a.a., with molecular weight of 58-74 kDa.

Background

EDAR Protein functions as a receptor specifically for EDA isoform TAA, distinguishing it from isoform TA-2. This receptor potentially mediates the activation of NF-kappa-B and JNK pathways, suggesting its involvement in signaling cascades associated with immune responses. Additionally, EDAR may play a role in promoting caspase-independent cell death. Its binding to EDARADD and association with key proteins such as TRAF1, TRAF2, TRAF3, and NIK underscore its role in complex signaling networks, emphasizing its significance in cellular processes beyond immune modulation, potentially contributing to cellular survival and programmed cell death mechanisms.

Species

Mouse

Source

HEK293

Tag

C-hFc

Accession

Q9R187 (E27-I189)

Gene ID
Molecular Construction
N-term
EDAR (E27-I189)
Accession # Q9R187
hFc
C-term
Synonyms
rMuTumor necrosis factor receptor superfamily member EDAR/EDAR, Fc; Tumor necrosis factor receptor superfamily member EDAR; Anhidrotic ectodysplasin receptor 1; Downless; Ectodermal dysplasia receptor; Ectodysplasin-A receptor
AA Sequence

EDSNCGENEYHNQTTGLCQQCPPCRPGEEPYMSCGYGTKDDDYGCVPCPAEKFSKGGYQICRRHKDCEGFFRATVLTPGDMENDAECGPCLPGYYMLENRPRNIYGMVCYSCLLAPPNTKECVGATSGVSAHSSSTSGGSTLSPFQHAHKELSGQGHLATALI

Molecular Weight

58-74 kDa

Purity

Greater than 95% as determined by reducing SDS-PAGE

Appearance

Lyophilized powder.

Formulation

Lyophilized from a 0.2 μm filtered solution of PBS, pH 7.4.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Storage & Stability

Stored at -20°C for 2 years. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Documentation

EDAR Protein, Mouse (HEK293, Fc) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Salutation

Applicant Name *

 

Email Address *

Phone Number *

 

Organization Name *

Department *

 

Requested quantity *

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
EDAR Protein, Mouse (HEK293, Fc)
Cat. No.:
HY-P70115
Quantity:
MCE Japan Authorized Agent: