1. Recombinant Proteins
  2. Cytokines and Growth Factors
  3. TNF Superfamily
  4. TNF Receptor Superfamily
  5. EDAR
  6. EDAR Protein, Mouse (HEK293, Fc)

EDAR protein is a receptor for the EDA isoform TAA, which, unlike TA-2, may activate the NF-kappa-B and JNK pathways, indicating its involvement in immune signaling. In addition, EDAR may cause caspase-independent cell death. EDAR Protein, Mouse (HEK293, Fc) is the recombinant mouse-derived EDAR protein, expressed by HEK293 , with C-hFc labeled tag.

연구목적의 판매만을 진행합니다. 환자를 대상으로 한 판매는 하지 않습니다.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

사이즈 가격 재고 수량
10 μg 해외재고보유
50 μg 해외재고보유
100 μg   견적 받기  

* 장바구니에 담기 전 물품의 수량을 선택해 주십시오.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • 제품 설명

제품 설명

EDAR protein is a receptor for the EDA isoform TAA, which, unlike TA-2, may activate the NF-kappa-B and JNK pathways, indicating its involvement in immune signaling. In addition, EDAR may cause caspase-independent cell death. EDAR Protein, Mouse (HEK293, Fc) is the recombinant mouse-derived EDAR protein, expressed by HEK293 , with C-hFc labeled tag.

Background

EDAR Protein functions as a receptor specifically for EDA isoform TAA, distinguishing it from isoform TA-2. This receptor potentially mediates the activation of NF-kappa-B and JNK pathways, suggesting its involvement in signaling cascades associated with immune responses. Additionally, EDAR may play a role in promoting caspase-independent cell death. Its binding to EDARADD and association with key proteins such as TRAF1, TRAF2, TRAF3, and NIK underscore its role in complex signaling networks, emphasizing its significance in cellular processes beyond immune modulation, potentially contributing to cellular survival and programmed cell death mechanisms.

Species

Mouse

Source

HEK293

Tag

C-hFc

Accession

Q9R187 (E27-I189)

Gene ID
Molecular Construction
N-term
EDAR (E27-I189)
Accession # Q9R187
hFc
C-term
Protein Length

Partial

Synonyms
rMuTumor necrosis factor receptor superfamily member EDAR/EDAR, Fc; Tumor necrosis factor receptor superfamily member EDAR; Anhidrotic ectodysplasin receptor 1; Downless; Ectodermal dysplasia receptor; Ectodysplasin-A receptor
AA Sequence

EDSNCGENEYHNQTTGLCQQCPPCRPGEEPYMSCGYGTKDDDYGCVPCPAEKFSKGGYQICRRHKDCEGFFRATVLTPGDMENDAECGPCLPGYYMLENRPRNIYGMVCYSCLLAPPNTKECVGATSGVSAHSSSTSGGSTLSPFQHAHKELSGQGHLATALI

분자량

58-74 kDa

Glycosylation
Yes
Purity

≥ 95%, as determined by reducing SDS-PAGE.

Appearance

Lyophilized powder.

Formulation

Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

선적

Room temperature in continental US; may vary elsewhere.

각종 서류

EDAR Protein, Mouse (HEK293, Fc) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

최근 본 상품:

온라인 문의

Your information is safe with us. * Required Fields.

EDAR Protein, Mouse (HEK293, Fc)

 

Requested Quantity *

고객명 *

 

호칭

메일주소 *

 

전화번호 *

Department

 

회사명 *

City

Country or Region *

     

비고

대량구매 문의

Inquiry Information

상품명:
EDAR Protein, Mouse (HEK293, Fc)
Cat. No.:
HY-P70115
수량:
MCE Japan Authorized Agent: