EGF Protein, Canine (P.pastoris)

The EGF protein plays a key role in promoting the growth of a variety of epidermal and epithelial tissues in vivo and in vitro and in stimulating the proliferation of certain fibroblasts in cell culture. In addition, it also has the effect of magnesium-stimulating hormone, causing magnesium reabsorption in the renal distal convoluted tubule through the participation of EGFR and the activation of magnesium channel TRPM6. EGF Protein, Canine (P.pastoris) is the recombinant canine-derived EGF protein, expressed by P. pastoris , with tag free.

Epidermal Growth Factor (EGF) is a potent stimulator of growth for various epidermal and epithelial tissues both in vivo and in vitro, as well as some fibroblasts in cell culture. This multifunctional protein plays a vital role in cellular processes, particularly in promoting the proliferation and development of tissues. Beyond its role in tissue growth, EGF acts as a magnesiotropic hormone, facilitating magnesium reabsorption in the renal distal convoluted tubule through the engagement of EGFR and activation of the magnesium channel TRPM6. Additionally, EGF interacts with EGFR, promoting EGFR dimerization, and engages with RHBDF1 and RHBDF2, potentially influencing EGF's intracellular trafficking and degradation pathways. These interactions underline the complex and versatile functions of EGF in both growth and signaling processes within the cell.

Measured in a cell proliferation assay using Balb 3T3 mouse embryonic fibroblasts. The ED₅₀ for this effect is typically 0.1-0.6 ng/mL.

Canine

P. pastoris

Tag Free

Q9BEA0 (N973-R1024)

403657  [NCBI]

Partial

NGYRECPSSYDGYCLYNGVCMYIEAVDRYACNCVFGYVGERCQHRDLKWELR

Approximately 6.2 kDa

≥ 95%, as determined by reducing SDS-PAGE.

Solution.

Supplied as a 0.22 μm filtered solution of PBS, pH 7.4, 5% trehalose, 5% mannitol and 0.01% Tween 80.

<1 EU/μg, determined by LAL method.

N/A.

Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.

Shipping with dry ice.