1. Recombinant Proteins
  2. Cytokines and Growth Factors
  3. EGF Superfamily
  4. EGF
  5. EGF Protein, Canine (P.pastoris)

EGF Protein, Canine (P.pastoris)

Cat. No.: HY-P72980
COA Handling Instructions

The EGF protein plays a key role in promoting the growth of a variety of epidermal and epithelial tissues in vivo and in vitro and in stimulating the proliferation of certain fibroblasts in cell culture. In addition, it also has the effect of magnesium-stimulating hormone, causing magnesium reabsorption in the renal distal convoluted tubule through the participation of EGFR and the activation of magnesium channel TRPM6. EGF Protein, Canine (P.pastoris) is the recombinant canine-derived EGF protein, expressed by P. pastoris , with tag free. The total length of EGF Protein, Canine (P.pastoris) is 52 a.a., with molecular weight of ~6.2 kDa.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Price Stock Quantity
Free Sample   Apply now
5 μg $42 In-stock
10 μg $65 In-stock
20 μg $105 In-stock
50 μg $200 In-stock
100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

The EGF protein plays a key role in promoting the growth of a variety of epidermal and epithelial tissues in vivo and in vitro and in stimulating the proliferation of certain fibroblasts in cell culture. In addition, it also has the effect of magnesium-stimulating hormone, causing magnesium reabsorption in the renal distal convoluted tubule through the participation of EGFR and the activation of magnesium channel TRPM6. EGF Protein, Canine (P.pastoris) is the recombinant canine-derived EGF protein, expressed by P. pastoris , with tag free. The total length of EGF Protein, Canine (P.pastoris) is 52 a.a., with molecular weight of ~6.2 kDa.

Background

Epidermal Growth Factor (EGF) is a potent stimulator of growth for various epidermal and epithelial tissues both in vivo and in vitro, as well as some fibroblasts in cell culture. This multifunctional protein plays a vital role in cellular processes, particularly in promoting the proliferation and development of tissues. Beyond its role in tissue growth, EGF acts as a magnesiotropic hormone, facilitating magnesium reabsorption in the renal distal convoluted tubule through the engagement of EGFR and activation of the magnesium channel TRPM6. Additionally, EGF interacts with EGFR, promoting EGFR dimerization, and engages with RHBDF1 and RHBDF2, potentially influencing EGF's intracellular trafficking and degradation pathways. These interactions underline the complex and versatile functions of EGF in both growth and signaling processes within the cell.

Biological Activity

Measured in a cell proliferation assay using Balb 3T3 mouse embryonic fibroblasts. The ED50 for this effect is typically 0.1-0.6 ng/mL.

Species

Canine

Source

P. pastoris

Tag

Tag Free

Accession

Q9BEA0 (N973-R1024)

Gene ID
Molecular Construction
N-term
EGF (N973-R1024)
Accession # Q9BEA0
C-term
Synonyms
Pro-epidermal growth factor; Urogastrone; EGF; HOMG4
AA Sequence

NGYRECPSSYDGYCLYNGVCMYIEAVDRYACNCVFGYVGERCQHRDLKWELR

Molecular Weight

Approximately 6.2 kDa

Purity

Greater than 95% as determined by reducing SDS-PAGE.

Appearance

Solution.

Formulation

Supplied as a 0.2 μm filtered solution of PBS, pH 7.4. Normally 5 % - 8 % trehalose, mannitol and 0.01% Tween 80 are added as protectants before lyophilization.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

N/A.

Storage & Stability

Stored at -80°C for 1 year. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.

Shipping

Shipping with dry ice.

Documentation

EGF Protein, Canine (P.pastoris) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Salutation

Applicant Name *

 

Email Address *

Phone Number *

 

Organization Name *

Department *

 

Requested quantity *

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
EGF Protein, Canine (P.pastoris)
Cat. No.:
HY-P72980
Quantity:
MCE Japan Authorized Agent: