EIF1B Protein, Human (His)
EIF1B Protein likely intricately participates in translation, playing a crucial role in facilitating accurate and efficient protein synthesis within cellular machinery. Its involvement suggests a key function in orchestrating various steps required for proper decoding of mRNA and subsequent assembly of polypeptide chains. EIF1B Protein, Human (His) is the recombinant human-derived EIF1B protein, expressed by E. coli , with N-6*His labeled tag.
- Species: Human
- Source: E. coli
-
Storage:Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
To place orders, for customer services and technical support, please contact: MedChemExpress USA
Tel: 609-228-6898 E-mail: [email protected] [email protected]
-
Biological Activity
-
Technical Parameters
-
Product Properties
- Documentation
- Help & FAQs
Biological Activity
EIF1B Protein likely intricately participates in translation, playing a crucial role in facilitating accurate and efficient protein synthesis within cellular machinery. Its involvement suggests a key function in orchestrating various steps required for proper decoding of mRNA and subsequent assembly of polypeptide chains. EIF1B Protein, Human (His) is the recombinant human-derived EIF1B protein, expressed by E. coli , with N-6*His labeled tag.
EIF1B protein is likely intricately involved in the complex process of translation, playing a crucial role in facilitating the accurate and efficient synthesis of proteins within the cellular machinery. Its participation in translation suggests a key function in orchestrating the various steps required for the proper decoding of mRNA and subsequent assembly of polypeptide chains.
Technical Parameters
-
Species Human
-
Source E. coli
-
Tag N-6*His
-
Accession
O60739 (M1-F113)
-
Molecular Construction
-
N-term
-
6*His
-
EIF1B (M1-F113)
Accession # O60739 -
C-term
-
-
Protein Length
Full Length
-
Synonyms
EIF1B; Eukaryotic Translation Initiation Factor 1B, Isoform CRA_a; Eukaryotic Translation Initiation Factor 1B; Eukaryotic Translation Initiation Factor 1b; GC20; Translation Factor Sui1 Homolog; Protein Translation Factor SUI1 Homolog GC20; GC20 Protein;
-
AA Sequence
MSTIQNLQSFDPFADATKGDDLLPAGTEDYIHIRIQQRNGRKTLTTVQGIADDYDKKKLVKAFKKKFACNGTVIEHPEYGEVIQLQGDQRKNICQFLLEVGIVKEEQLKVHGF
-
Predicted Molecular Mass
15 kDa
-
Molecular Weight
Approximately 13-20 kDa, based on SDS-PAGE under reducing conditions.
-
Purity
≥ 95%, as determined by reducing SDS-PAGE.
Product Properties
Lyophilized powder.
<1 EU/μg, determined by LAL method.
It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).
Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Room temperature in continental US; may vary elsewhere.
Documentation
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
Powered by Bioz
