EIF3M Protein, Human (His-SUMO)

The EIF3M protein is a component of the eIF-3 complex and promotes protein synthesis initiation (eg, mRNA recruitment, scanning, and ribosomal subunit attachment) (PubMed:17403899, PubMed:25849773). EIF3M Protein, Human (His-SUMO) is the recombinant human-derived EIF3M protein, expressed by E. coli , with N-His, N-SUMO labeled tag.

For research use only. We do not sell to patients.
  • Species: Human
  • Source: E. coli
  • Storage:
    Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
  • Biological Activity
  • Technical Parameters
  • Product Properties
  • Documentation
  • Help & FAQs

Biological Activity

Description

The EIF3M protein is a component of the eIF-3 complex and promotes protein synthesis initiation (eg, mRNA recruitment, scanning, and ribosomal subunit attachment) (PubMed:17403899, PubMed:25849773). EIF3M Protein, Human (His-SUMO) is the recombinant human-derived EIF3M protein, expressed by E. coli , with N-His, N-SUMO labeled tag.

Background

EIF3M protein serves as an integral component of the eukaryotic translation initiation factor 3 (eIF-3) complex, crucial for orchestrating multiple steps in the initiation of protein synthesis. This complex associates with the 40S ribosome, facilitating the recruitment of essential factors such as eIF-1, eIF-1A, eIF-2:GTP:methionyl-tRNAi, and eIF-5 to form the 43S pre-initiation complex (43S PIC). EIF-3M actively promotes mRNA recruitment to the 43S PIC, scanning of the mRNA for AUG recognition, and subsequent prevention of premature joining of the 40S and 60S ribosomal subunits prior to initiation. Furthermore, the EIF-3 complex plays a pivotal role in the disassembly and recycling of post-termination ribosomal complexes. Remarkably, EIF3M is instrumental in the translation initiation of specific mRNAs associated with cell proliferation, encompassing processes like cell cycling, differentiation, and apoptosis. It employs distinct modes of RNA stem-loop binding to exert either translational activation or repression. Additionally, in the context of microbial infection, EIF3M may facilitate virus entry during infection with herpes simplex virus 1 (HSV1) or herpes simplex virus 2 (HSV2).

Technical Parameters

  • Species Human
  • Source E. coli
  • Tag N-His;N-SUMO
  • Accession
  • Gene ID
  • Molecular Construction
    • N-term
    • 6*His-SUMO
    • EIF3M (S2-T374)
      Accession # Q7L2H7-1
    • C-term
  • Protein Length

    Full Length of Isoform-1 Mature Protein

  • Synonyms

    EIF3M; Transport And Golgi Organization 7 Homolog (Drosophila); Prev. PCID1; Transport And Golgi Organization 7 Homolog; TANGO7; Dendritic Cell Protein; Hfl-B5; B5 Receptor; GA17; HFL-B5; PCI Domain Containing 1 (Herpesvirus Entry Mediator); HFLB5; PCI Do

  • AA Sequence

    SVPAFIDISEEDQAAELRAYLKSKGAEISEENSEGGLHVDLAQIIEACDVCLKEDDKDVESVMNSVVSLLLILEPDKQEALIESLCEKLVKFREGERPSLRLQLLSNLFHGMDKNTPVRYTVYCSLIKVAASCGAIQYIPTELDQVRKWISDWNLTTEKKHTLLRLLYEALVDCKKSDAASKVMVELLGSYTEDNASQARVDAHRCIVRALKDPNAFLFDHLLTLKPVKFLEGELIHDLLTIFVSAKLASYVKFYQNNKDFIDSLGLLHEQNMAKMRLLTFMGMAVENKEISFDTMQQELQIGADDVEAFVIDAVRTKMVYCKIDQTQRKVVVSHSTHRTFGKQQWQQLYDTLNAWKQNLNKVKNSLLSLSDT

  • Predicted Molecular Mass

    58.4 kDa

  • Purity

    ≥ 90%, as determined by reducing SDS-PAGE.

Product Properties

Appearance

Lyophilized powder.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O.

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Calculators

Reconstitution Calculator

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) Volume (to add to vial)
=
Mass (in vial) Mass (in vial)
÷
Desired Reconstitution Concentration Desired Reconstitution Concentration
Dilution Calculator

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

Concentration (start) Concentration (start)
×
Volume (start) Volume (start)
=
Concentration (final) Concentration (final)
×
Volume (final) Volume (final)
The Specific Activity Calculator Equation
  • Specific Activity (Unit/mg)
  • Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) Specific Activity (Unit/mg)
Unit/mg
= 106 ÷
Biological Activity (ED50) Biological Activity (ED50)
106 ÷
ng/mL
MOQ
Minimum order quantity
100 mg

Get Quote In-stock

Other size
Get Quote
Please select quantity
Amount: USD 0.00