EIF4E Protein, Human
Based on 1 Customer Validation
IF4E protein plays multiple roles in cells, regulating processes such as protein synthesis, mRNA export, RNA processing and splicing. As part of the eIF4F protein complex, IF4E recognizes the mRNA cap and promotes ribosome binding. It is also involved in translation repression and regulation of mRNA stability. In P bodies, IF4E is involved in storing translationally inactive mRNA. In addition, IF4E also plays a role in spermatogenesis, neurogenesis, and mRNA nuclear-cytoplasmic transport. The ability of IF4E to participate in mRNA export relies on binding to the m7G cap and the EIF4E-sensitive element (4ESE). LRPPRC promotes the formation of EIF4E-dependent mRNA export complexes. The action of IF4E changes the composition of nuclear pores and promotes the nuclear export of specific mRNAs. EIF4E Protein, Human is the recombinant human-derived EIF4E protein, expressed by E. coli , with tag free.
- Species: Human
- Source: E. coli
-
Stockage:Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Activité biologique
Description
IF4E protein plays multiple roles in cells, regulating processes such as protein synthesis, mRNA export, RNA processing and splicing. As part of the eIF4F protein complex, IF4E recognizes the mRNA cap and promotes ribosome binding. It is also involved in translation repression and regulation of mRNA stability. In P bodies, IF4E is involved in storing translationally inactive mRNA. In addition, IF4E also plays a role in spermatogenesis, neurogenesis, and mRNA nuclear-cytoplasmic transport. The ability of IF4E to participate in mRNA export relies on binding to the m7G cap and the EIF4E-sensitive element (4ESE). LRPPRC promotes the formation of EIF4E-dependent mRNA export complexes. The action of IF4E changes the composition of nuclear pores and promotes the nuclear export of specific mRNAs. EIF4E Protein, Human is the recombinant human-derived EIF4E protein, expressed by E. coli , with tag free.
Background
IF4E proteins play multifaceted roles in cellular processes, coordinating important functions in the cytoplasm and nucleus. In the cytoplasm, it acts as a key initiator and regulator of protein synthesis. Furthermore, within the nucleus, IF4E is essential for exporting a portion of mRNA to the cytoplasm, facilitating processes such as RNA capping, processing, and splicing. As a component of the eIF4F protein complex, IF4E plays a critical role in recognizing the mRNA cap, unwinding 5' terminal secondary structure, and recruiting the mRNA to the ribosome. It binds to the 7-methylguanosine (m7G)-containing mRNA cap, thereby initiating protein synthesis and inducing mRNA secondary structure unwinding, thereby promoting ribosome binding. IF4E cooperates with EIF4G1 to counteract EIF1-EIF4G1-promoted scanning, which is critical for TISU translation, where TISU element recognition eliminates the need for scanning. In addition to translation initiation, IF4E also acts as a cytoplasmic regulator of translation and stability. It is part of the CYFIP1-EIF4E-FMR1 complex and mediates translation repression by binding to the mRNA cap. Furthermore, in P bodies, IF4E participates in a complex that stores translationally inactive mRNA and prevents its degradation. Its diverse functions extend to roles in spermatogenesis, neurogenesis, and nuclear-cytoplasmic transport of mRNA. Notably, the involvement of IF4E in mRNA export relies on its ability to bind the m7G cap and the presence of the EIF4E-sensitive element (4ESE). LRPPRC promotes interaction with 4ESE to form an EIF4E-dependent mRNA export complex. IF4E-dependent mRNA export, independent of ongoing protein or RNA synthesis, is XPO1-dependent and LRPPRC interacts with XPO1. The dynamic action of IF4E alters the composition of nuclear pores and promotes RNA export by regulating the expression of key factors. It significantly promotes the nuclear export of specific mRNAs, including the cell cyclins CCND1, NOS2/iNOS, and MDM2.
Données de validation de MCE
-
Purity - SDS-PAGE
Purity - SDS-PAGE
Technical Parameters
-
Species Human
-
Source E. coli
-
Tag Tag Free
-
Accession
AAH12611.1 (M1-V217)
-
Molecular Construction
-
N-term
-
EIF4E (M1-V217)
Accession # AAH12611.1 -
C-term
-
-
Protein Length
Full Length
-
Synonyms
EIF4E; EIF-4F 25 KDa Subunit; Prev. EIF4EL1; Eukaryotic Translation Initiation Factor 4E-Like 1; Prev. EIF4F; AUTS19; EIF4E1; CBP; MRNA Cap-Binding Protein; Eukaryotic Translation Initiation Factor 4E; EIF-4E
-
AA Sequence
MATVEPETTPTPNPPTTEEEKTESNQEVANPEHYIKHPLQNRWALWFFKNDKSKTWQANLRLISKFDTVEDFWALYNHIQLSSNLMPGCDYSLFKDGIEPMWEDEKNKRGGRWLITLNKQQRRSDLNRFWLETLLCLIGESFDDYSDDVCGAVVNVRAKGDKIAIWTTECENREAVTHIGRVYKERLGLPPKIVIGYQSHADTATKSGSTTKNRFVV
-
Masse moléculaire
Approximately 25 kDa, based on SDS-PAGE under reducing conditions.
-
Pureté
≥ 85%, as determined by reducing SDS-PAGE.
Product Properties
Lyophilized powder
1.Lyophilized from a 0.22 μm filtered solution of 20 mM PB, 150 mM NaCl, pH 7.4.
2.Lyophilized from a 0.22 μm filtered solution of 50 mM Tris-HCl, 300 mM NaCl, 200 mM arginine, pH 8.0.
Please refer to the lot-specific COA for specific buffer information.
Note: For SPR assay, please replace the buffer. Primary amine components (e.g., Tris, imidazole) can affect protein-coupled chips.
<1 EU/μg, determined by LAL method.
It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).
Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Room temperature in continental US; may vary elsewhere.
Documentation
-
Fiche technique (237 KB)
-
SDS (252 KB)
- English - EN (252 KB)
- Français - FR (252 KB)
- Deutsch - DE (252 KB)
- Norwegian - NO (252 KB)
- Español - ES (252 KB)
- Swedish - SV (252 KB)
- Italian - IT (252 KB)
- Korean - KR (252 KB)
- Portuguese - PT (252 KB)
-
Instruction de manipulation (2659 KB)
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)