EIF4EBP2 Protein, Human (His)
Based on 1 Customer Validation
EIF4EBP2 is a translation initiation repressor protein that plays a critical regulatory role in synaptic plasticity, learning, and memory. In the hypophosphorylated state, EIF4EBP2 competes with EIF4G1/EIF4G3, forms a complex with EIF4E, and inhibits translation. EIF4EBP2 Protein, Human (His) is the recombinant human-derived EIF4EBP2 protein, expressed by E. coli , with N-6*His labeled tag.
- Species: Human
- Source: E. coli
-
Storage:Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Biological Activity
Description
EIF4EBP2 is a translation initiation repressor protein that plays a critical regulatory role in synaptic plasticity, learning, and memory. In the hypophosphorylated state, EIF4EBP2 competes with EIF4G1/EIF4G3, forms a complex with EIF4E, and inhibits translation. EIF4EBP2 Protein, Human (His) is the recombinant human-derived EIF4EBP2 protein, expressed by E. coli , with N-6*His labeled tag.
Background
EIF4EBP2, a repressor of translation initiation, plays a pivotal role in synaptic plasticity, learning, and memory formation. Acting as a key regulator of EIF4E activity, the hypophosphorylated form of EIF4EBP2 competes with EIF4G1/EIF4G3, forming a robust complex with EIF4E, thereby repressing translation. In contrast, the hyperphosphorylated form dissociates from EIF4E, enabling the interaction between EIF4G1/EIF4G3 and EIF4E, ultimately initiating translation. Enriched in the brain, EIF4EBP2 acts as a critical modulator of synapse activity and neuronal stem cell renewal, contributing to the regulation of protein translation in response to various signaling pathways, including MAP kinase and mTORC1. The intricate interplay between phosphorylation events and protein interactions underscores EIF4EBP2's multifaceted role in orchestrating cellular responses to external stimuli.
Technical Parameters
-
Species Human
-
Source E. coli
-
Tag N-6*His
-
Accession
Q13542 (M1-I120)
-
Molecular Construction
-
N-term
-
6*His
-
EIF4EBP2 (M1-I120)
Accession # Q13542 -
C-term
-
-
Protein Length
Full Length
-
Synonyms
EIF4EBP2; EIF4EBP2 Protein; Eukaryotic Translation Initiation Factor 4E Binding Protein 2; PHASII; Eukaryotic Translation Initiation Factor 4E-Binding Protein 2; 4E-BP2; EIF4E-Binding Protein 2; 4EBP2; Phosphorylated, Heat And Acid Stable Regulated By Ins
-
AA Sequence
MSSSAGSGHQPSQSRAIPTRTVAISDAAQLPHDYCTTPGGTLFSTTPGGTRIIYDRKFLLDRRNSPMAQTPPCHLPNIPGVTSPGTLIEDSKVEVNNLNNLNNHDRKHAVGDDAQFEMDI
-
Predicted Molecular Mass
15.1 kDa
-
Molecular Weight
Approximately 19 kDa & 20 kDa, based on SDS-PAGE under reducing conditions.
-
Purity
≥ 90%, as determined by reducing SDS-PAGE.
Product Properties
Lyophilized powder.
Lyophilized from a 0.22 μm filtered solution of 20 mM Tris-HCl, 150 mM NaCl, pH 8.0 .
Note: For SPR assay, please replace the buffer. Primary amine components (e.g., Tris, imidazole) can affect protein-coupled chips.
<1 EU/μg, determined by LAL method.
It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).
Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Room temperature in continental US; may vary elsewhere.
Documentation
-
Data Sheet (235 KB)
-
SDS (251 KB)
- English - EN (251 KB)
- Français - FR (251 KB)
- Deutsch - DE (251 KB)
- Norwegian - NO (251 KB)
- Español - ES (251 KB)
- Swedish - SV (251 KB)
- Italian - IT (251 KB)
- Korean - KR (251 KB)
- Portuguese - PT (251 KB)
-
Handling Instructions (2659 KB)
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)