Eotaxin-3/CCL26 Protein, Human
Based on 1 Customer Validation
Eotaxin-3/CCL26 Protein, Human is a CC chemokine that binds to chemokine receptors CCR3 or CX3CR1 and is a chemotactic agent for eosinophils and basophils that mediates inflammatory responses. Eotaxin-3/CCL26 Protein, Human is a recombinant human Eotaxin-3/CCL26 (T24-L94) protein expressed by E. coli
.
- Species: Human
- Source: E. coli
-
Storage:Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Biological Activity
Description
Eotaxin-3/CCL26 Protein, Human is a CC chemokine that binds to chemokine receptors CCR3 or CX3CR1 and is a chemotactic agent for eosinophils and basophils that mediates inflammatory responses. Eotaxin-3/CCL26 Protein, Human is a recombinant human Eotaxin-3/CCL26 (T24-L94) protein expressed by E. coli
[1].
Background
CCL26, also known as Eotaxin-3, macrophage inflammatory protein 4-alpha (MIP-4-alpha), a small cytokine of the CC chemokine family, is located on chromosome 7 in the human genome. It is expressed in a variety of tissues, including heart, lung and ovary, and in endothelial cells stimulated by the cytokine interleukin 4. It is chemotactic for eosinophils and basophils and acts by binding to the cell surface chemokine receptor CCR3 or CX3CR1. Among them, CCR3 is a CCR selectively expressed on eosinophils, basophils and some Th2 cells.CCR3 is thought to be associated with Th2-mediated diseases, including AD and asthma, while CX3CR1 is associated with Th1-mediated diseases, such as rheumatoid arthritis, diabetes mellitus, lichen planus and psoriasis. CCL26 may play a dual role in the pathogenesis of allergy and other diseases such as eosinophilic esophagitis and Churg-Strauss syndrome by attracting both CCR3-expressing cells and CX3CR1-expressing cells. In addition, CCL26 also acts as a natural antagonist of CCR1, CCR2 and CCR5[1][2].
In Vitro
CCL26 (100 nM, 18 h) induces eosinophil migration, where eosinophil migration is induced within 6 hours, then migration stabilizes until 12 hours and increases further to 18 hours with no increase after 18 hours. And CCR3 blockade completely inhibits eosinophil migration[2].
In Vivo
CCL26 (human, 5 μg in 400 μL PBS, i.p.) induces calcium mobilization not only through CCR3 but also through CX3CR1 in a PTX-sensitive manner, and induces chemotactic. Besides, it can rapidly recruit mouse eosinophils and intravenously transferred human CD16+ NK cells into the peritoneal cavity in BALB/c mice[3].
Verified Bioactivity
Full biological activity determined by a chemotaxis bioassay using human CCR3 transfected HEK293 cells is in a concentration range of 0.5-2.0 μg/ml.
MCE Validation Data
-
Purity - SDS-PAGE
Purity - SDS-PAGE
Technical Parameters
-
Species Human
-
Source E. coli
-
Tag Tag Free
-
Accession
Q9Y258 (T24-L94)
-
Molecular Construction
-
N-term
-
CCL26 (T24-L94)
Accession # Q9Y258 -
C-term
-
-
Protein Length
Full Length of Mature Protein
-
Synonyms
CCL26; MIP-4a; Prev. SCYA26; Small Inducible Cytokine Subfamily A (Cys-Cys), Member 26; Eotaxin-3; Chemokine (C-C Motif) Ligand 26; TSC-1; Small Inducible Cytokine A26; Macrophage Inflammatory Protein 4-Alpha; C-C Motif Chemokine 26; Thymic Stroma Chemoki
-
AA Sequence
TRGSDISKTCCFQYSHKPLPWTWVRSYEFTSNSCSQRAVIFTTKRGKKVCTHPRKKWVQKYISLLKTPKQL
-
Predicted Molecular Mass
8.5 kDa
-
Molecular Weight
Approximately 13 kDa, based on SDS-PAGE under reducing conditions.
-
Purity
≥ 95%, as determined by reducing SDS-PAGE.
Product Properties
Lyophilized powder.
Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4.
<1 EU/μg, determined by LAL method.
It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).
Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Room temperature in continental US; may vary elsewhere.
Documentation
-
Data Sheet (262 KB)
-
SDS (251 KB)
- English - EN (251 KB)
- Français - FR (251 KB)
- Deutsch - DE (251 KB)
- Norwegian - NO (251 KB)
- Español - ES (251 KB)
- Swedish - SV (251 KB)
- Italian - IT (251 KB)
- Korean - KR (251 KB)
- Portuguese - PT (251 KB)
-
Handling Instructions (2659 KB)
References
[1]. Marie-Chantal Larose, et al. Correlation between CCL26 production by human bronchial epithelial cells and airway eosinophils: Involvement in patients with severe eosinophilic asthma. J Allergy Clin Immunol. 2015 Oct;136(4):904-13. [Content Brief]
[2]. Banwell ME, et al. Regulation of human eotaxin-3/CCL26 expression: modulation by cytokines and glucocorticoids. Cytokine. 2002 Mar 21;17(6):317-23. [Content Brief]
[3]. Véronique Provost, et al. CCL26/eotaxin-3 is more effective to induce the migration of eosinophils of asthmatics than CCL11/eotaxin-1 and CCL24/eotaxin-2. J Leukoc Biol. 2013 Aug;94(2):213-22. [Content Brief]
[4]. Larose MC, et al. Correlation between CCL26 production by human bronchial epithelial cells and airway eosinophils: Involvement in patients with severe eosinophilic asthma. J Allergy Clin Immunol. 2015 Oct;136(4):904-13. [Content Brief]
[5]. Takashi Nakayama, et al. Eotaxin-3/CC chemokine ligand 26 is a functional ligand for CX3CR1. J Immunol. 2010 Dec 1;185(11):6472-9. [Content Brief]
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)