EpCAM/TROP1 Protein, Human (Biotinylated, HEK293, Fc)

SHP-2 protein is a phosphatase enzyme that plays a crucial role in cell signaling. It is involved in regulating cellular processes such as cell growth, differentiation, and survival. Dysregulation of SHP-2 protein has been implicated in various diseases, including cancer and developmental disorders. EpCAM/TROP1 Protein, Human (Biotinylated, HEK293, Fc) is the recombinant human-derived EpCAM/TROP1 protein, expressed by HEK293 , with C-hFc labeled tag.

The EpCAM/TROP1 Protein, belonging to a family that includes at least two type I membrane proteins, encodes a carcinoma-associated antigen expressed on most normal epithelial cells and gastrointestinal carcinomas. Functioning as a homotypic calcium-independent cell adhesion molecule, this antigen holds significance as a target for immunotherapy in the treatment of human carcinomas. Mutations in this gene are associated with congenital tufting enteropathy. The gene exhibits biased expression, with markedly elevated levels in the colon (RPKM 501.8), small intestine (RPKM 391.0), and nine other tissues, suggesting its specific involvement in various physiological contexts across multiple organs.

Human

HEK293

C-hFc

NP_002345 (Q24-K265)

4072  [NCBI]

Extracellular domain

Biotin

QEECVCENYKLAVNCFVNNNRQCQCTSVGAQNTVICSKLAAKCLVMKAEMNGSKLGRRAKPEGALQNNDGLYDPDCDESGLFKAKQCNGTSMCWCVNTAGVRRTDKDTEITCSERVRTYWIIIELKHKAREKPYDSKSLRTALQKEITTRYQLDPKFITSILYENNVITIDLVQNSSQKTQNDVDIADVAYYFEKDVKGESLFHSKKMDLTVNGEQLDLDPGQTLIYYVDEKAPEFSMQGLK

≥ 90%, as determined by reducing SDS-PAGE.

<1 EU/μg, determined by LAL method.