2. Recombinant Proteins
  3. CAR-T Related Proteins CD Antigens Biotinylated Proteins
  4. Epithelial Cell Adhesion Molecule (EpCAM) Stem Cell CD Proteins Dendritic Cell CD Proteins Epithelial cell CD Proteins
  5. CD326/EpCAM
  6. EpCAM/TROP1 Protein, Human (Biotinylated, HEK293, Fc)

EpCAM/TROP1 Protein, Human (Biotinylated, HEK293, Fc)

Cat. No.: HY-P77531
Instrucciones de manejo Technical Support

SHP-2 protein is a phosphatase enzyme that plays a crucial role in cell signaling. It is involved in regulating cellular processes such as cell growth, differentiation, and survival. Dysregulation of SHP-2 protein has been implicated in various diseases, including cancer and developmental disorders. EpCAM/TROP1 Protein, Human (Biotinylated, HEK293, Fc) is the recombinant human-derived EpCAM/TROP1 protein, expressed by HEK293 , with C-hFc labeled tag.

Para uso exclusivo en investigación. No vendemos a pacientes.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Tamaño Stock
50 μg   Obtener un presupuesto  
100 μg   Obtener un presupuesto  

* Seleccione Cantidad antes de agregar artículos.

Top Publications Citing Use of Products

  • Actividad biológica

  • Technical Parameters

  • Properties

  • Descripciòn

Descripciòn

SHP-2 protein is a phosphatase enzyme that plays a crucial role in cell signaling. It is involved in regulating cellular processes such as cell growth, differentiation, and survival. Dysregulation of SHP-2 protein has been implicated in various diseases, including cancer and developmental disorders. EpCAM/TROP1 Protein, Human (Biotinylated, HEK293, Fc) is the recombinant human-derived EpCAM/TROP1 protein, expressed by HEK293 , with C-hFc labeled tag.
Background

The EpCAM/TROP1 Protein, belonging to a family that includes at least two type I membrane proteins, encodes a carcinoma-associated antigen expressed on most normal epithelial cells and gastrointestinal carcinomas. Functioning as a homotypic calcium-independent cell adhesion molecule, this antigen holds significance as a target for immunotherapy in the treatment of human carcinomas. Mutations in this gene are associated with congenital tufting enteropathy. The gene exhibits biased expression, with markedly elevated levels in the colon (RPKM 501.8), small intestine (RPKM 391.0), and nine other tissues, suggesting its specific involvement in various physiological contexts across multiple organs.
Species

Human
Source

HEK293
Tag

C-hFc
Accession

NP_002345 (Q24-K265)
Gene ID
Molecular Construction
N-term
EpCAM (Q24-K265)
Accession # NP_002345
hFc
C-term
Protein Length

Extracellular domain
Conjugation

Biotin
Synonyms
Epithelial cell adhesion molecule; Ep-CAM; EGP; KSA; CD326; TROP1
AA Sequence

QEECVCENYKLAVNCFVNNNRQCQCTSVGAQNTVICSKLAAKCLVMKAEMNGSKLGRRAKPEGALQNNDGLYDPDCDESGLFKAKQCNGTSMCWCVNTAGVRRTDKDTEITCSERVRTYWIIIELKHKAREKPYDSKSLRTALQKEITTRYQLDPKFITSILYENNVITIDLVQNSSQKTQNDVDIADVAYYFEKDVKGESLFHSKKMDLTVNGEQLDLDPGQTLIYYVDEKAPEFSMQGLK

Predicted Molecular Mass
54.1 kDa
Glycosylation
Yes
Pureza

≥ 90%, as determined by reducing SDS-PAGE.
Endotoxin Level

<1 EU/μg, determined by LAL method.
Documentación
Instrucciones de manejo (2659 KB)

EpCAM/TROP1 Protein, Human (Biotinylated, HEK293, Fc) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Productos vistos recientemente:

Consulta en línea

Your information is safe with us. * Required Fields.

EpCAM/TROP1 Protein, Human (Biotinylated, HEK293, Fc)

  

Requested Quantity *

Nombre del solicitante *

 

Saludo

Direcciòn del E-mail *

 

Número de teléfono *

Department

 

Nombre de la Organizaciòn *

City

Provincia

Country or Region *

      

Observaciones

Consulta para venta a granel

Inquiry Information

Nombre del producto:
EpCAM/TROP1 Protein, Human (Biotinylated, HEK293, Fc)
Cat. No.:
HY-P77531
Cantidad:
MCE Japan Authorized Agent:

Request for HNMR Report

Please fill out this form to request the QC report. We will send it to your Email address shortly.

Your information is safe with us. * Required Fields.

Nombre del producto

  

Lot #

Nombre del solicitante *

 

Country or Region *

Direcciòn del E-mail *

     

Número de teléfono *

 

Nombre de la Organizaciòn *

Observaciones

SAFETY DATA SHEET (SDS)

Request for HNMR Report

We have received your request and will respond to you as soon as possible.