EpCAM/TROP1 Protein, Rat (HEK293, Fc)

The EpCAM/TROP1 protein serves as a multifunctional molecule that promotes homogeneous interactions between intestinal epithelial cells (IECs) and intraepithelial lymphocytes (IELs) in the mucosal epithelium. This suggests a crucial role in establishing an immune barrier against mucosal infection. EpCAM/TROP1 Protein, Rat (HEK293, Fc) is the recombinant rat-derived EpCAM/TROP1 protein, expressed by HEK293 , with C-hFc labeled tag.

The EpCAM/TROP1 protein serves a multifaceted role, potentially acting as a physical homophilic interaction molecule that facilitates direct contact between intestinal epithelial cells (IECs) and intraepithelial lymphocytes (IELs) at the mucosal epithelium. This interaction suggests a pivotal function in establishing an immunological barrier, serving as the first line of defense against mucosal infections. Beyond its involvement in mucosal immunity, EpCAM/TROP1 plays a significant role in the proliferation and differentiation of embryonic stem cells. Moreover, it exhibits regulatory influence by up-regulating the expression of FABP5, MYC, and cyclins A and E, implicating EpCAM/TROP1 in the modulation of key cellular processes. Its monomeric nature and interaction with phosphorylated CLDN7 underscore the intricacies of its molecular interactions, shedding light on its diverse functions in cellular physiology.

Rat

HEK293

C-hFc

O55159 (Q24-T266)

171577  [NCBI]

Extracellular Domain

QKDCVCNNYKLTSRCYENENGECQCTSYGTQNTVICSKLASKCLVMKAEMTHSKSGRRMKPEGAIQNNDGLYDPECDEQGLFKAKQCNGTATCWCVNTAGVRRTDKDTEITCSERVRTYWIIIELKHKERAQPYNFESLHTALQDTFASRYMLNPKFIKSIMYENNVITIDLMQNSSQKTQDDVDIADVAYYFEKDVKGESLFHSSKSMDLRVNGELLDLDPGQTLIYYVDEKAPEFSMQGLT

Approximately 61 kDa & 37 kDa,based on SDS-PAGE under reducing conditions.

≥ 95%, as determined by reducing SDS-PAGE.

<1 EU/μg, determined by LAL method.