EphB2 Protein, Human (Active, sf9, His-GST)

EphB2 protein is a receptor tyrosine kinase that participates in bidirectional signaling with the transmembrane ephrin B ligand. It guides commissural axons in the developing cerebral cortex, efferent growth cones of the inner ear, and retinal ganglion cell axons. EphB2 Protein, Human (sf9, His-GST) is the recombinant human-derived EphB2 protein, expressed by Sf9 insect cells , with N-His, N-GST labeled tag.

For research use only. We do not sell to patients.
  • Species: Human
  • Source: Sf9 insect cells
  • Storage:
    Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.
  • Biological Activity
  • Technical Parameters
  • Product Properties
  • Documentation
  • Help & FAQs

Biological Activity

Description

EphB2 protein is a receptor tyrosine kinase that participates in bidirectional signaling with the transmembrane ephrin B ligand. It guides commissural axons in the developing cerebral cortex, efferent growth cones of the inner ear, and retinal ganglion cell axons. EphB2 Protein, Human (sf9, His-GST) is the recombinant human-derived EphB2 protein, expressed by Sf9 insect cells , with N-His, N-GST labeled tag.

Background

EphB2 protein is a receptor tyrosine kinase that interacts with transmembrane ephrin-B ligands on neighboring cells, resulting in bidirectional signaling. The pathway downstream of EphB2 is known as forward signaling, while the pathway downstream of ephrin ligands is referred to as reverse signaling. EphB2 plays a crucial role in axon guidance during development, particularly in the guidance of commissural axons connecting the temporal lobes of the cerebral cortex, as well as the guidance of inner ear efferent growth cones and retinal ganglion cell axons. It also regulates the development and maturation of dendritic spines and promotes the formation of excitatory synapses, counteracting the negative regulation mediated by ARHGEF15 upon activation by EFNB1. Furthermore, EphB2 is involved in various developmental processes, including angiogenesis, palate development, and endolymph production in the inner ear. Its complex with EFNB2 controls cell movement and adhesion during the tubularization of the urethra and septation of the cloaca. Additionally, EphB2 may have tumor suppressor activity and could influence platelet activation and blood coagulation.

Technical Parameters

  • Species Human
  • Source Sf9 insect cells
  • Tag N-10*His;N-GST
  • Accession
  • Gene ID
  • Molecular Construction
    • N-term
    • His-GST
    • EphB2 (G570-V987)
      Accession # P29323-3
    • C-term
  • Protein Length

    Partial

  • Synonyms

    EPHB2; Ephrin Type-B Receptor 2 Variant; Prev. EPHT3; Protein-Tyrosine Kinase HEK5; Prev. DRT; Elk-Related Tyrosine Kinase; Prev. ERK; ELK-Related Tyrosine Kinase; Tyrosine-Protein Kinase Receptor EPH-3; Eph Tyrosine Kinase 3; Ephrin Type-B Receptor 2; EPH Tyrosine Kinase 3; Tyro5; BDPLT22; Hek5; EphB2; Developmentally-Regulated Eph-Related Tyrosine Kinase; TYRO5; Renal Carcinoma Antigen NY-REN-47; EPTH3; Tyrosine-Protein Kinase TYRO5; CAPB; EPH-Like Kinase 5; PCBC; EK5; HEK5; EPH Receptor B2; Receptor Protein-Tyrosine Kinase

  • AA Sequence

    GFERADSEYTDKLQHYTSGHMTPGMKIYIDPFTYEDPNEAVREFAKEIDISCVKIEQVIGAGEFGEVCSGHLKLPGKREIFVAIKTLKSGYTEKQRRDFLSEASIMGQFDHPNVIHLEGVVTKSTPVMIITEFMENGSLDSFLRQNDGQFTVIQLVGMLRGIAAGMKYLADMNYVHRDLAARNILVNSNLVCKVSDFGLSRFLEDDTSDPTYTSALGGKIPIRWTAPEAIQYRKFTSASDVWSYGIVMWEVMSYGERPYWDMTNQDVINAIEQDYRLPPPMDCPSALHQLMLDCWQKDRNHRPKFGQIVNTLDKMIRNPNSLKAMAPLSSGINLPLLDRTIPDYTSFNTVDEWLEAIKMGQYKESFANAGFTSFDVVSQMMMEDILRVGVTLAGHQKKILNSIQVMRAQMNQIQSVEV

  • Predicted Molecular Mass

    75.2 kDa

  • Molecular Weight

    Approximately 65 kDa, based on SDS-PAGE under reducing conditions.

  • Glycosylation

    Yes

  • Purity

    ≥ 90%, as determined by reducing SDS-PAGE.

Product Properties

Appearance

Solution.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

Please use rapid thawing with running water to thaw the protein.

Storage & Stability

Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.

Shipping

Shipping with dry ice.

Calculators

Reconstitution Calculator

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) Volume (to add to vial)
=
Mass (in vial) Mass (in vial)
÷
Desired Reconstitution Concentration Desired Reconstitution Concentration
Dilution Calculator

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

Concentration (start) Concentration (start)
×
Volume (start) Volume (start)
=
Concentration (final) Concentration (final)
×
Volume (final) Volume (final)
The Specific Activity Calculator Equation
  • Specific Activity (Unit/mg)
  • Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) Specific Activity (Unit/mg)
Unit/mg
= 106 ÷
Biological Activity (ED50) Biological Activity (ED50)
106 ÷
ng/mL
MOQ
Minimum order quantity
100 mg

Get Quote In-stock

Other size
Get Quote
Please select quantity
Amount: USD 0.00