1. Recombinant Proteins
  2. Cytokines and Growth Factors Receptor Proteins Enzymes & Regulators Kinases
  3. Ephrin/Eph Family Receptor Tyrosine Kinases Transferases (EC 2) Protein Tyrosine Kinases Pseudokinases TK
  4. Eph Receptors Eph
  5. EphB2
  6. EphB2 Protein, Human (Active, sf9, His-GST)

EphB2 protein is a receptor tyrosine kinase that participates in bidirectional signaling with the transmembrane ephrin B ligand. It guides commissural axons in the developing cerebral cortex, efferent growth cones of the inner ear, and retinal ganglion cell axons. EphB2 Protein, Human (sf9, His-GST) is the recombinant human-derived EphB2 protein, expressed by Sf9 insect cells , with N-His, N-GST labeled tag.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Price Stock Quantity
50 μg Get quote 2 - 3 weeks 1 - 2 Weeks 3 - 4 weeks 2 - 3 weeks
100 μg   Get quote  
Synthetic products have potential research and development risk.

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

EphB2 protein is a receptor tyrosine kinase that participates in bidirectional signaling with the transmembrane ephrin B ligand. It guides commissural axons in the developing cerebral cortex, efferent growth cones of the inner ear, and retinal ganglion cell axons. EphB2 Protein, Human (sf9, His-GST) is the recombinant human-derived EphB2 protein, expressed by Sf9 insect cells , with N-His, N-GST labeled tag.

Background

EphB2 protein is a receptor tyrosine kinase that interacts with transmembrane ephrin-B ligands on neighboring cells, resulting in bidirectional signaling. The pathway downstream of EphB2 is known as forward signaling, while the pathway downstream of ephrin ligands is referred to as reverse signaling. EphB2 plays a crucial role in axon guidance during development, particularly in the guidance of commissural axons connecting the temporal lobes of the cerebral cortex, as well as the guidance of inner ear efferent growth cones and retinal ganglion cell axons. It also regulates the development and maturation of dendritic spines and promotes the formation of excitatory synapses, counteracting the negative regulation mediated by ARHGEF15 upon activation by EFNB1. Furthermore, EphB2 is involved in various developmental processes, including angiogenesis, palate development, and endolymph production in the inner ear. Its complex with EFNB2 controls cell movement and adhesion during the tubularization of the urethra and septation of the cloaca. Additionally, EphB2 may have tumor suppressor activity and could influence platelet activation and blood coagulation.

Species

Human

Source

Sf9 insect cells

Tag

N-His;N-GST

Accession

P29323-3 (G570-V987)

Gene ID
Molecular Construction
N-term
His-GST
EphB2 (G570-V987)
Accession # P29323-3
C-term
Protein Length

Partial

Synonyms
EPHB2; Ephrin type-B receptor 2; EK5; DRT; EPHT3; ERK; HEK5; TYRO5
AA Sequence

GFERADSEYTDKLQHYTSGHMTPGMKIYIDPFTYEDPNEAVREFAKEIDISCVKIEQVIGAGEFGEVCSGHLKLPGKREIFVAIKTLKSGYTEKQRRDFLSEASIMGQFDHPNVIHLEGVVTKSTPVMIITEFMENGSLDSFLRQNDGQFTVIQLVGMLRGIAAGMKYLADMNYVHRDLAARNILVNSNLVCKVSDFGLSRFLEDDTSDPTYTSALGGKIPIRWTAPEAIQYRKFTSASDVWSYGIVMWEVMSYGERPYWDMTNQDVINAIEQDYRLPPPMDCPSALHQLMLDCWQKDRNHRPKFGQIVNTLDKMIRNPNSLKAMAPLSSGINLPLLDRTIPDYTSFNTVDEWLEAIKMGQYKESFANAGFTSFDVVSQMMMEDILRVGVTLAGHQKKILNSIQVMRAQMNQIQSVEV

Predicted Molecular Mass
75.2 kDa
Molecular Weight

Approximately 65 kDa,based on SDS-PAGE under reducing conditions.

Glycosylation
Yes
Purity

≥ 90%, as determined by reducing SDS-PAGE.

Appearance

Solution.

Formulation

Supplied as a 0.22 μm filtered solution of 20 mM Tris, 500 mM NaCl, pH 7.4, 3 mM DTT, 10% gly
Note: For SPR assay, please replace the buffer. Primary amine components (e.g., Tris, imidazole) can affect protein-coupled chips.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

Please use rapid thawing with running water to thaw the protein.

Storage & Stability

Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.

Shipping

Shipping with dry ice.

Documentation
Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

EphB2 Protein, Human (Active, sf9, His-GST)

 

Requested Quantity *

Applicant Name *

 

Salutation

Email Address *

 

Phone Number *

Department

 

Organization Name *

City

State

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
EphB2 Protein, Human (Active, sf9, His-GST)
Cat. No.:
HY-P73000
Quantity:
MCE Japan Authorized Agent: