1. Recombinant Proteins
  2. Cytokines and Growth Factors Receptor Proteins Enzymes & Regulators
  3. Ephrin/Eph Family Receptor Tyrosine Kinases Protein Tyrosine Kinases
  4. Eph Receptors
  5. EphB2
  6. EphB2 Protein, Human (sf9, His-GST)

EphB2 Protein, Human (sf9, His-GST)

Cat. No.: HY-P73000
Handling Instructions

EphB2 protein is a receptor tyrosine kinase that participates in bidirectional signaling with the transmembrane ephrin B ligand. It guides commissural axons in the developing cerebral cortex, efferent growth cones of the inner ear, and retinal ganglion cell axons. EphB2 Protein, Human (sf9, His-GST) is the recombinant human-derived EphB2 protein, expressed by Sf9 insect cells , with N-His, N-GST labeled tag. The total length of EphB2 Protein, Human (sf9, His-GST) is 418 a.a., with molecular weight of ~65 kDa.

For research use only. We do not sell to patients.

Protein Expression Service

Size Stock
50 μg   Get quote  
100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

EphB2 protein is a receptor tyrosine kinase that participates in bidirectional signaling with the transmembrane ephrin B ligand. It guides commissural axons in the developing cerebral cortex, efferent growth cones of the inner ear, and retinal ganglion cell axons. EphB2 Protein, Human (sf9, His-GST) is the recombinant human-derived EphB2 protein, expressed by Sf9 insect cells , with N-His, N-GST labeled tag. The total length of EphB2 Protein, Human (sf9, His-GST) is 418 a.a., with molecular weight of ~65 kDa.

Background

EphB2 protein is a receptor tyrosine kinase that interacts with transmembrane ephrin-B ligands on neighboring cells, resulting in bidirectional signaling. The pathway downstream of EphB2 is known as forward signaling, while the pathway downstream of ephrin ligands is referred to as reverse signaling. EphB2 plays a crucial role in axon guidance during development, particularly in the guidance of commissural axons connecting the temporal lobes of the cerebral cortex, as well as the guidance of inner ear efferent growth cones and retinal ganglion cell axons. It also regulates the development and maturation of dendritic spines and promotes the formation of excitatory synapses, counteracting the negative regulation mediated by ARHGEF15 upon activation by EFNB1. Furthermore, EphB2 is involved in various developmental processes, including angiogenesis, palate development, and endolymph production in the inner ear. Its complex with EFNB2 controls cell movement and adhesion during the tubularization of the urethra and septation of the cloaca. Additionally, EphB2 may have tumor suppressor activity and could influence platelet activation and blood coagulation.

Species

Human

Source

Sf9 insect cells

Tag

N-His;N-GST

Accession

P29323-3 (G570-V987)

Gene ID
Molecular Construction
N-term
His-GST
EphB2 (G570-V987)
Accession # P29323-3
C-term
Synonyms
EPHB2; Ephrin type-B receptor 2; EK5; DRT; EPHT3; ERK; HEK5; TYRO5
AA Sequence

GFERADSEYTDKLQHYTSGHMTPGMKIYIDPFTYEDPNEAVREFAKEIDISCVKIEQVIGAGEFGEVCSGHLKLPGKREIFVAIKTLKSGYTEKQRRDFLSEASIMGQFDHPNVIHLEGVVTKSTPVMIITEFMENGSLDSFLRQNDGQFTVIQLVGMLRGIAAGMKYLADMNYVHRDLAARNILVNSNLVCKVSDFGLSRFLEDDTSDPTYTSALGGKIPIRWTAPEAIQYRKFTSASDVWSYGIVMWEVMSYGERPYWDMTNQDVINAIEQDYRLPPPMDCPSALHQLMLDCWQKDRNHRPKFGQIVNTLDKMIRNPNSLKAMAPLSSGINLPLLDRTIPDYTSFNTVDEWLEAIKMGQYKESFANAGFTSFDVVSQMMMEDILRVGVTLAGHQKKILNSIQVMRAQMNQIQSVEV

Molecular Weight

Approximately 65 kDa

Purity

Greater than 90% as determined by reducing SDS-PAGE

Endotoxin Level

<1 EU/μg, determined by LAL method.

Documentation
Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Salutation

Applicant Name *

 

Email Address *

Phone Number *

 

Organization Name *

Department *

 

Requested quantity *

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
EphB2 Protein, Human (sf9, His-GST)
Cat. No.:
HY-P73000
Quantity:
MCE Japan Authorized Agent: