Ephrin-B2/EFNB2 Protein, Mouse (HEK293, Fc-His)

Ephrin-B2/EFNB2 Protein is a transmembrane ligand for Eph receptors, mediating bidirectional signaling and binding to EPHA4, EPHA3, and EPHB4. It regulates cell adhesion, migration, heart morphogenesis, angiogenesis, and axon orientation. It also interacts with PDZRN3. Ephrin-B2/EFNB2 Protein, Mouse (HEK293, Fc-His) is the recombinant mouse-derived Ephrin-B2/EFNB2 protein, expressed by HEK293 , with C-hFc, C-6*His labeled tag. The total length of Ephrin-B2/EFNB2 Protein, Mouse (HEK293, Fc-His) is 199 a.a., with molecular weight of 65-80 kDa.

Ephrin-B2/EFNB2 Protein is a cell surface transmembrane ligand for Eph receptors, a family of receptor tyrosine kinases that play crucial roles in neuronal, vascular, and epithelial development. It binds to neighboring cells' Eph receptors, leading to contact-dependent bidirectional signaling. This interaction triggers forward signaling downstream of the receptor and reverse signaling downstream of the ephrin ligand. Ephrin-B2/EFNB2 binds promiscuously to receptor tyrosine kinases such as EPHA4, EPHA3, and EPHB4. It cooperates with EPHB4 to regulate cell adhesion, migration, heart morphogenesis, and angiogenesis. Additionally, it participates in guiding the orientation of longitudinally projecting axons and interacts with PDZRN3 (By similarity).

Mouse

HEK293

C-hFc;C-6*His

P52800 (R29-E227)

13642  [NCBI]

RSIVLEPIYWNSSNSKFLPGQGLVLYPQIGDKLDIICPKVDSKTVGQYEYYKVYMVDKDQADRCTIKKENTPLLNCARPDQDVKFTIKFQEFSPNLWGLEFQKNKDYYIISTSNGSLEGLDNQEGGVCQTRAMKILMKVGQDASSAGSARNHGPTRRPELEAGTNGRSSTTSPFVKPNPGSSTDGNSAGHSGNNLLGSE

65-80 kDa

Greater than 95% as determined by reducing SDS-PAGE.

Lyophilized powder.

Lyophilized from a 0.2 μm filtered solution of 20 mM PB, 150 mM NaCl, pH 7.4.

<1 EU/μg, determined by LAL method.

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH₂O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Stored at -20°C for 2 years. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Room temperature in continental US;may vary elsewhere.