Epiregulin Protein, Human (HEK293, Fc)

For research use only. We do not sell to patients.

Size	Price	Stock	Quantity
Free Sample		Apply now
5 μg	$125	In-stock	Estimated Time of Arrival: December 31
20 μg	$338	In-stock	Estimated Time of Arrival: December 31
100 μg	$950	In-stock	Estimated Time of Arrival: December 31
250 μg		Get quote

* Please select Quantity before adding items.

Biological Activity	Measured in a cell proliferation assay using Balb/3T3 mouse embryonic fibroblast cells and the ED₅₀ is typically 1-8 μg/mL.
Species	Human
Source	HEK293
Tag	N-hFc
Accession	O14944 (V63-L108)
Gene ID	2069 [NCBI]
Synonyms	Proepiregulin; Epiregulin; EPR; EREG
AA Sequence	VSITKCSSDMNGYCLHGQCIYLVDMSQNYCRCEVGYTGVRCEHFFL
Molecular Weight	Approximately 37 kDa
Purity	Greater than 95% as determined by reducing SDS-PAGE
Appearance	Lyophilized powder.
Formulation	Lyophilized from a 0.2 μm filtered solution of PBS, pH 7.4. Normally 5 % - 8 % trehalose, mannitol and 0.01% Tween 80 are added as protectants before lyophilization.
Endotoxin Level	<1 EU/μg, determined by LAL method.
Reconstitution	It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH₂O.
Storage & Stability	Stored at -20°C. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer. It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Shipping	Room temperature in continental US; may vary elsewhere.
Documentation	Select Batch: Data Sheet (232 KB) SDS (251 KB) COA (232 KB) Handling Instructions (2659 KB)

Epiregulin Protein, Human (HEK293, Fc) Related Classifications

Help & FAQs

Do most proteins show cross-species activity?
Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Concentration _(start) × Volume _(start) = Concentration _(final) × Volume _(final)

This equation is commonly abbreviated as: C₁V₁ = C₂V₂

Specific Activity (Unit/mg) = 10⁶ ÷ Biological Activity (ED₅₀)

Product Name

Salutation

Applicant Name *

Email address *

Phone number *

Organization name *

Department *

Requested quantity *

Country or Region *

Remarks

Name
Email *

	Sorry, but the email address you supplied was invalid.