1. Recombinant Proteins
  2. Cytokines and Growth Factors
  3. EGF Superfamily
  4. Epiregulin
  5. Epiregulin Protein, Human (HEK293, Fc)

Epiregulin Protein, a ligand for EGFR and ERBB4, crucially influences inflammation, wound healing, tissue repair, and oocyte maturation. It stimulates tyrosine phosphorylation of both receptors, regulating angiogenesis, vascular remodeling, and cell proliferation. Interactions with EGFR and ERBB4 contribute to intricate signaling pathways, essential for diverse physiological responses and cellular functions. Epiregulin Protein, Human (HEK293, Fc) is the recombinant human-derived Epiregulin protein, expressed by HEK293 , with N-hFc labeled tag.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Price Stock Quantity
Free Sample (5 μg)   Apply now
2 μg In-stock
5 μg In-stock
10 μg In-stock
20 μg In-stock
50 μg In-stock
100 μg In-stock
500 μg In-stock
1 mg In-stock
> 1 mg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

Epiregulin Protein, a ligand for EGFR and ERBB4, crucially influences inflammation, wound healing, tissue repair, and oocyte maturation. It stimulates tyrosine phosphorylation of both receptors, regulating angiogenesis, vascular remodeling, and cell proliferation. Interactions with EGFR and ERBB4 contribute to intricate signaling pathways, essential for diverse physiological responses and cellular functions. Epiregulin Protein, Human (HEK293, Fc) is the recombinant human-derived Epiregulin protein, expressed by HEK293 , with N-hFc labeled tag.

Background

Epiregulin, a ligand for the EGF receptor (EGFR) and ERBB4, plays a crucial role in cellular processes such as inflammation, wound healing, tissue repair, and oocyte maturation. It achieves this by stimulating the tyrosine phosphorylation of both EGFR and ERBB4. Additionally, epiregulin is involved in the regulation of angiogenesis, vascular remodeling, and cell proliferation. Through its interactions with EGFR and ERBB4, epiregulin contributes to intricate signaling pathways that are essential for various physiological responses and cellular functions.

Biological Activity

Measured in a cell proliferation assay using Balb/3T3 mouse embryonic fibroblast cells. The ED50 for this effect is <8 μg/mL.

  • Measured in a cell proliferation assay using Balb/3T3 mouse embryonic fibroblast cells. The ED50 for this effect is 0.7141 ng/mL, corresponding to a specific activity is 1.4×106 units/mg.
Species

Human

Source

HEK293

Tag

N-hFc

Accession

O14944/NP_001423.1 (V63-L108)

Gene ID
Molecular Construction
N-term
hFc
Epiregulin (V63-L108)
Accession # O14944/NP_001423.1
C-term
Protein Length

Partial

Synonyms
Proepiregulin; Epiregulin; EPR; EREG
AA Sequence

VSITKCSSDMNGYCLHGQCIYLVDMSQNYCRCEVGYTGVRCEHFFL

Molecular Weight

Approximately 35 kDa

Purity
  • Greater than 95% as determined by reducing SDS-PAGE.
Appearance

Lyophilized powder.

Formulation

Lyophilized from a 0.2 μm filtered solution of PBS, pH 7.4.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O.

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Documentation

Epiregulin Protein, Human (HEK293, Fc) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Requested Quantity *

Applicant Name *

 

Salutation

Email Address *

 

Phone Number *

Department

 

Organization Name *

City

State

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
Epiregulin Protein, Human (HEK293, Fc)
Cat. No.:
HY-P73031
Quantity:
MCE Japan Authorized Agent: