1. Recombinant Proteins
  2. Epiregulin Protein, Human

Epiregulin Protein, Human

Cat. No.: HY-P7011
Handling Instructions

Epiregulin Protein, Human is a growth regulator and a member of the epidermal growth factor (EGF) family. Epiregulin is a tumor growth-inhibitory factor inducing morphological changes in human epidermoid carcinoma HeLa cells.

For research use only. We do not sell to patients.

Protein Expression Service

Recombinant Proteins-MedChemExpress
Size Price Stock Quantity
10 μg $140 In-stock
Estimated Time of Arrival: December 31
50 μg $460 In-stock
Estimated Time of Arrival: December 31
100 μg   Get quote  
250 μg   Get quote  

* Please select Quantity before adding items.

  • Technical Parameters

  • Properties

  • Documentation

Synonyms
rHuEpiregulin; EREG; EPR
Species

Human

Source

E. coli

Accession

O14944 (V60-L108)

Gene ID

2069

Molecular Weight

Approximately 5.6 kDa

AA Sequence

VAQVSITKCSSDMNGYCLHGQCIYLVDMSQNYCRCEVGYTGVRCEHFFL

Biological Activity
The ED50 is <2 ng/mL as measured by murine Ballb/c 3T3 cells, corresponding to a specific activity of >5 × 105 units/mg.
Appearance

Lyophilized powder.

Formulation

Lyophilized after extensive dialysis against PBS, pH 7.4.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in sterile distilled water or aqueous buffer containing 0.1% BSA.

Storage & Stability

Stored at -20°C. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer. It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Background

The human epiregulin gene encoded a 163-residue putative transmembrane precursor containing an EGF-like domain in the internal segment, and the structural organization was similar to that of other members of the EGF family that bind to EGF receptors. Epiregulin has certain characteristics that are different from those of the classical members of the EGF family, EGF and transforming growth factor alpha, including mitogenic responses on several normal cells and binding to EGF receptors on epidermoid carcinoma A431 cells. Northern blot analysis shows the expression of human epiregulin to be mainly on peripheral blood macrophages and the placenta in normal tissues, and is highest on epithelial tumour cell lines in various types of tumour cell lines. Epiregulin is involved in certain physiological processes such as maintenance or development of normal cell growth, and the progression of carcinomas[1].

Documentation
References
  • Molarity Calculator

  • Dilution Calculator

The molarity calculator equation

Mass (g) = Concentration (mol/L) × Volume (L) × Molecular Weight (g/mol)

Mass   Concentration   Volume   Molecular Weight *
= × ×

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Salutation

Applicant Name *

 

Email address *

Phone number *

 

Organization name *

Department *

 

Requested quantity *

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
Epiregulin Protein, Human
Cat. No.:
HY-P7011
Quantity:
MCE Japan Authorized Agent: