Copy Link Print Information

ERMAP Protein, Human (HEK293, His)

Customer Review

Based on 1 Customer Validation

ERMAP protein potentially serves as a cell-adhesion or receptor molecule in erythroid cells, suggesting involvement in crucial interactions or signaling events. The precise mechanisms, ligands, and broader implications of ERMAP's activity in erythroid cell biology require further investigation. Unraveling ERMAP's function may provide insights into its significance in hematopoiesis and related physiological processes. ERMAP Protein, Human (HEK293, His) is the recombinant human-derived ERMAP protein, expressed by HEK293 , with C-6*His labeled tag.

For research use only. We do not sell to patients.
  • Species: Human
  • Source: HEK293
  • Storage:
    Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
  • Experimental Validation Results for ERMAP Protein, Human (HEK293, His)
  • Experimental Validation Results for ERMAP Protein, Human (HEK293, His)
  • ERMAP Protein, Human (HEK293, His) Product Image
Size
Price
Stock
Quantity
Amount: USD 0.00
Please select quantity
or
or

* Please select Quantity before adding items.

To place orders, for customer services and technical support, please contact: MedChemExpress USA

Tel: 609-228-6898 E-mail: [email protected] [email protected]

Service
Data Download

To place orders, for customer services and technical support, please contact:

609-228-6898
[email protected] [email protected]
Find Your Local Distributor Your local distributor: Hycultec GmbHHycultec
  • Biological Activity
  • Technical Parameters
  • Product Properties
  • Documentation
  • Help & FAQs
Top Publications Citing

Use of MCE Products

Biological Activity

Description

ERMAP protein potentially serves as a cell-adhesion or receptor molecule in erythroid cells, suggesting involvement in crucial interactions or signaling events. The precise mechanisms, ligands, and broader implications of ERMAP's activity in erythroid cell biology require further investigation. Unraveling ERMAP's function may provide insights into its significance in hematopoiesis and related physiological processes. ERMAP Protein, Human (HEK293, His) is the recombinant human-derived ERMAP protein, expressed by HEK293 , with C-6*His labeled tag.

Background

ERMAP protein exhibits a potential role as a cell-adhesion or receptor molecule specifically in erythroid cells. This implies its involvement in mediating interactions or signaling events crucial for erythroid cell function. The precise mechanisms and ligands involved in ERMAP-mediated cell adhesion or receptor activity, as well as its broader implications in erythroid cell biology, warrant further investigation. Unraveling the intricacies of ERMAP's function in erythroid cells may shed light on its significance in hematopoiesis and related physiological processes.

Verified Bioactivity

1. Measured by its ability to inhibit anti-CD3 antibody induced IL-2 by Jurkat cells. The ED50 for this effect is 0.5-2.0 μg/mL.
2. Measured by its ability to inhibit the anti-CD3/anti-CD28-induced surface expression of CD25 and CD69 on Jurkat human acute T cell leukemia cells. The results indicated that 3.5 μg/ml ERMAP protein could inhibit the CD25+, CD69+ phenotypic differentiation of Jurkat cells induced by anti-CD3 and anti-CD28.

MCE Validation Data

  • Purity - SDS-PAGE

    Purity - SDS-PAGE

    ≥ 95%, as determined by reducing SDS-PAGE.

  • Bioactivity - Cell-Based Assay

    Bioactivity - Cell-Based Assay

    Measured by its ability to inhibit anti-CD3 antibody induced IL-2 by Jurkat cells. The ED50 for this effect is 0.9745 μg/mL, corresponding to a specific activity is 1026.167 units/mg.

Technical Parameters

  • Species Human
  • Source HEK293
  • Tag C-6*His
  • Accession

    Q96PL5 (H30-A155)

  • Gene ID
    114625  [NCBI]
  • Molecular Construction
    • N-term
    • ERMAP (H30-A155)
      Accession # Q96PL5
    • 6*His
    • C-term
  • Protein Length

    Extracellular Domain

  • Synonyms

    ERMAP; Erythroblast Membrane-Associated Protein (Scianna Blood Group); Prev. RD; Alternative Protein ERMAP; Prev. SC; Scianna Blood Group (Sc); Erythroid Membrane-Associated Protein; Radin Blood Group (Rd); Scianna Blood Group Antigen; Scianna Blood Group

  • AA Sequence

    HAGDAGKFHVALLGGTAELLCPLSLWPGTVPKEVRWLRSPFPQRSQAVHIFRDGKDQDEDLMPEYKGRTVLVRDAQEGSVTLQILDVRLEDQGSYRCLIQVGNLSKEDTVILQVAAPSVGSLSPSA

  • Molecular Weight

    Approximately 16 kDa & 19 kDa, based on SDS-PAGE under reducing conditions.

  • Glycosylation

    Yes

  • Purity

    ≥ 95%, as determined by reducing SDS-PAGE.

Product Properties

Appearance

Lyophilized powder

Formulation

1.Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4, 5% trehalose, 5% mannitol, 0.01% Tween 80.
2.Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4, 8% trehalose.
Please refer to the lot-specific COA for specific buffer information.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Calculators

Reconstitution Calculator

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) Volume (to add to vial)
=
Mass (in vial) Mass (in vial)
÷
Desired Reconstitution Concentration Desired Reconstitution Concentration
Dilution Calculator

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

Concentration (start) Concentration (start)
×
Volume (start) Volume (start)
=
Concentration (final) Concentration (final)
×
Volume (final) Volume (final)
The Specific Activity Calculator Equation
  • Specific Activity (Unit/mg)
  • Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) Specific Activity (Unit/mg)
Unit/mg
= 106 ÷
Biological Activity (ED50) Biological Activity (ED50)
106 ÷
ng/mL
MOQ
Minimum order quantity
100 mg

Get Quote In-stock

Other size
Get Quote
Please select quantity
Amount: USD 0.00

Measured by its ability to inhibit anti-CD3-induced proliferation of stimulated CTLL-2 mouse cytotoxic T cells. The ED50 this effect is 0.8023 μg/ml, corresponding to a specific activity is 1246.42 units/mg.

Assay Types
  • 1/16

    MedChemExpress Validation
     ≥ 95%, as determined by reducing SDS-PAGE.

  • 1/16

    MedChemExpress Validation
     Measured by its ability to inhibit anti-CD3 antibody induced IL-2 by Jurkat cells. The ED50 for this effect is 0.9745 μg/mL, corresponding to a specific activity is 1026.167 units/mg.

  • ERMAP Protein, Human (HEK293, His) Product Image
    1/16
  • Experimental Validation Results for ERMAP Protein, Human (HEK293, His)
  • Experimental Validation Results for ERMAP Protein, Human (HEK293, His)
  • ERMAP Protein, Human (HEK293, His) Product Image