ERMAP Protein, Human (HEK293, His)

ERMAP protein potentially serves as a cell-adhesion or receptor molecule in erythroid cells, suggesting involvement in crucial interactions or signaling events. The precise mechanisms, ligands, and broader implications of ERMAP's activity in erythroid cell biology require further investigation. Unraveling ERMAP's function may provide insights into its significance in hematopoiesis and related physiological processes. ERMAP Protein, Human (HEK293, His) is the recombinant human-derived ERMAP protein, expressed by HEK293 , with C-6*His labeled tag. The total length of ERMAP Protein, Human (HEK293, His) is 126 a.a., with molecular weight of ~16.0 kDa.

ERMAP protein exhibits a potential role as a cell-adhesion or receptor molecule specifically in erythroid cells. This implies its involvement in mediating interactions or signaling events crucial for erythroid cell function. The precise mechanisms and ligands involved in ERMAP-mediated cell adhesion or receptor activity, as well as its broader implications in erythroid cell biology, warrant further investigation. Unraveling the intricacies of ERMAP's function in erythroid cells may shed light on its significance in hematopoiesis and related physiological processes.

Human

HEK293

C-6*His

Q96PL5 (H30-A155)

114625  [NCBI]

HAGDAGKFHVALLGGTAELLCPLSLWPGTVPKEVRWLRSPFPQRSQAVHIFRDGKDQDEDLMPEYKGRTVLVRDAQEGSVTLQILDVRLEDQGSYRCLIQVGNLSKEDTVILQVAAPSVGSLSPSA

Approximately 16.0 kDa

• 
  Greater than 95% as determined by reducing SDS-PAGE.

Lyophilized powder

Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4.

<1 EU/μg, determined by LAL method.

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH₂O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Stored at -20°C for 2 years. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Room temperature in continental US; may vary elsewhere.