ETFR-2/TEAD-4 Protein, Mouse

ETFR-2/TEAD-4 protein is a key transcription factor that tightly regulates the Hippo signaling pathway and is an integral component of organ size control and tumor suppression. In this pathway, it mediates a kinase cascade involving MST1/MST2, SAV1, LATS1/2, and MOB1, leading to the inactivation of YAP1 and WWTR1/TAZ. ETFR-2/TEAD-4 Protein, Mouse is the recombinant mouse-derived ETFR-2/TEAD-4 protein, expressed by E. coli , with tag free. The total length of ETFR-2/TEAD-4 Protein, Mouse is 218 a.a., with molecular weight of ~25.7 kDa.

ETFR-2/TEAD-4, a pivotal transcription factor, assumes a critical role in the Hippo signaling pathway, a pathway intricately linked to organ size control and tumor suppression through the regulation of proliferation and apoptosis. This pathway involves a kinase cascade wherein MST1/MST2, in complex with its regulatory protein SAV1, phosphorylates and activates LATS1/2 in complex with its regulatory protein MOB1. Subsequently, MOB1 phosphorylates and inactivates the YAP1 oncoprotein and WWTR1/TAZ. ETFR-2/TEAD-4 acts by mediating the gene expression of YAP1 and WWTR1/TAZ, thus regulating crucial cellular processes such as proliferation, migration, and epithelial-mesenchymal transition (EMT) induction. The protein binds specifically and non-cooperatively to the Sph and GT-IIC 'enhansons' (5'-GTGGAATGT-3') and activates transcription. Additionally, it interacts with the M-CAT motif. While potentially playing a role in the embryonic development of skeletal muscle, ETFR-2/TEAD-4 also interacts with WWTR1/TAZ and YAP1, highlighting its multifaceted involvement in regulatory networks.

Mouse

E. coli

Tag Free

Q62296 (210R-427E)

21679  [NCBI]

RSIASSKLWMLEFSAFLERQQDPDTYNKHLFVHISQSSPSYSDPYLETVDIRQIYDKFPEKKGGLKELFERGPSNAFFLVKFWADLNTNIDDEGSAFYGVSSQYESPENMIITCSTKVCSFGKQVVEKVETEYARYENGHYLYRIHRSPLCEYMINFIHKLKHLPEKYMMNSVLENFTILQVVTNRDTQETLLCIAYVFEVSASEHGAQHHIYRLVKE

Approximately 25.7 kDa

Greater than 90% as determined by reducing SDS-PAGE.

Lyophilized powder

Lyophilized after extensive dialysis against solution in 10 mM Tris-HCl, 1 mM EDTA, 6% Trehalose, pH 8.0.

<1 EU/μg, determined by LAL method.

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH₂O.

Stored at -20°C for 2 years. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Room temperature in continental US; may vary elsewhere.