1. Recombinant Proteins
  2. Others
  3. FABP1/L-FABP Protein, Human (N-His)

FABP1/L-FABP Protein, Human (N-His)

Cat. No.: HY-P70264
COA Handling Instructions

FABP1 Protein, Human (His) is a Recombinant FABP1 Protein with a His-flag. FABP1 Protein is a cytoplasm protein and belongs to the calycin superfamily and FABP family.

For research use only. We do not sell to patients.

Protein Expression Service

Size Price Stock Quantity
10 μg $40 In-stock
50 μg $120 In-stock
100 μg $220 Get quote
500 μg $700 Get quote
1 mg $1100 Get quote
> 100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

  • References

Description

FABP1 Protein, Human (His) is a Recombinant FABP1 Protein with a His-flag. FABP1 Protein is a cytoplasm protein and belongs to the calycin superfamily and FABP family.

Background

FABP1 Protein is a cytoplasm protein and belongs to the calycin superfamily and FABP family. FABP1 is a liver-specific FABP that plays important roles in intracellular lipid metabolism in the liver[1].
FABP1 is expressed in renal proximal tubule cells and released into urine in response to hypoxia caused by decreased peritubular capillary blood flow[2].

Biological Activity

Data is not available.

Species

Human

Source

E. coli

Tag

N-6*His

Accession

P07148 (M1-I127)

Gene ID
Molecular Construction
N-term
6*His
FABP1 (M1-I127)
Accession # P07148
C-term
Synonyms
rHuFatty acid-binding protein/FABP1, His; Fatty Acid-Binding Protein Liver; Fatty Acid-Binding Protein 1; Liver-Type Fatty Acid-Binding Protein; L-FABP; FABP1; FABPL
AA Sequence

MSFSGKYQLQSQENFEAFMKAIGLPEELIQKGKDIKGVSEIVQNGKHFKFTITAGSKVIQNEFTVGEECELETMTGEKVKTVVQLEGDNKLVTTFKNIKSVTELNGDIITNTMTLGDIVFKRISKRI

Molecular Weight

13-15 kDa

Purity
  • Greater than 95% as determined by reducing SDS-PAGE.
Appearance

Lyophilized powder.

Formulation

Lyophilized from a 0.2 μm filtered solution of 20 mM PB, 150 mM NaCl, 0.5 M Argine, 50% Glycerol, 2 mM EDTA, pH 7.4 or 20 mM Tris-HCl, 150 mM NaCl, pH 8.0.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Storage & Stability

Stored at -20°C for 2 years. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Documentation
References

FABP1/L-FABP Protein, Human (N-His) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Salutation

Applicant Name *

 

Email Address *

Phone Number *

 

Organization Name *

Department *

 

Requested quantity *

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
FABP1/L-FABP Protein, Human (N-His)
Cat. No.:
HY-P70264
Quantity:
MCE Japan Authorized Agent: