FABP7 Protein, Human (His)

FABP7 Protein, Human (His) expresses in E. coliwith a His tag. Fatty Acid-Binding Protein 7 (FABP-7) is one of the subtypes of FABPs and preferentially binds to n-3 and n-9 polyunsaturated fatty acids (PUFAs) such as docosahexaenotic acid (DHA) and oleic acid, respectively. FABP-7 is thought to be an important molecule for cell proliferation in healthy as well as diseased organisms^[1].

FABP-7 is a well-known marker of neural stem cells and radial glia in the CNS. In the embryonic brain, FABP7 is essential for the maintenance and proliferation of neural stem-progenitor cells and radial glia^[2].

Human

E. coli

N-6*His

O15540 (V2-A132)

2173  [NCBI]

HHHHHHVEAFCATWKLTNSQNFDEYMKALGVGFATRQVGNVTKPTVIISQEGDKVVIRTLSTFKNTEISFQLGEEFDETTADDRNCKSVVSLDGDKLVHIQKWDGKETNFVREIKDGKMVMTLTFGDVVAVRHYEKA

Approximately 16.0 kDa

Greater than 95% as determined by reducing SDS-PAGE.

Lyophilized powder.

Lyophilized after extensive dialysis against 20 mM PB, 150 mM NaCl, pH 7.4.

<1 EU/μg, determined by LAL method.

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH₂O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Stored at -20°C for 2 years. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Room temperature in continental US; may vary elsewhere.

• [1]. Kagawa Y, et al. Role of FABP7 in tumor cell signaling. Adv Biol Regul. 2019;71:206-218.  [Content Brief]

  [2]. Kamizato K, et al. The role of fatty acid binding protein 7 in spinal cord astrocytes in a mouse model of experimental autoimmune encephalomyelitis. Neuroscience. 2019;409:120-129.  [Content Brief]