FABP7 Protein, Human (His)

Customer Review

Based on 1 Customer Validation

FABP7 Protein, Human (His) expresses in E. coliwith a His tag. Fatty Acid-Binding Protein 7 (FABP-7) is one of the subtypes of FABPs and preferentially binds to n-3 and n-9 polyunsaturated fatty acids (PUFAs) such as docosahexaenotic acid (DHA) and oleic acid, respectively. FABP-7 is thought to be an important molecule for cell proliferation in healthy as well as diseased organisms.

For research use only. We do not sell to patients.
  • Species: Human
  • Source: E. coli
  • Storage:
    Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
  • Biological Activity
  • Technical Parameters
  • Product Properties
  • Documentation
  • References
  • Help & FAQs

Biological Activity

Description

FABP7 Protein, Human (His) expresses in E. coliwith a His tag. Fatty Acid-Binding Protein 7 (FABP-7) is one of the subtypes of FABPs and preferentially binds to n-3 and n-9 polyunsaturated fatty acids (PUFAs) such as docosahexaenotic acid (DHA) and oleic acid, respectively. FABP-7 is thought to be an important molecule for cell proliferation in healthy as well as diseased organisms[1].

Background

FABP-7 is a well-known marker of neural stem cells and radial glia in the CNS. In the embryonic brain, FABP7 is essential for the maintenance and proliferation of neural stem-progenitor cells and radial glia[2].

Technical Parameters

  • Species Human
  • Source E. coli
  • Tag N-6*His
  • Accession
  • Gene ID
  • Molecular Construction
    • N-term
    • 6*His
    • FABP7 (V2-A132)
      Accession # O15540-1
    • C-term
  • Protein Length

    Full Length of Isoform-1

  • Synonyms

    FABP7; MRG; Fatty Acid Binding Protein 7; Mammary-Derived Growth Inhibitor-Related; B-FABP; Mammary-Derived Growth Inhibitor Related; BLBP; Fatty Acid Binding Protein 7, Brain; Brain-Type Fatty Acid-Binding Protein; Hypothetical Protein DKFZp547J2313; Fat

  • AA Sequence

    VEAFCATWKLTNSQNFDEYMKALGVGFATRQVGNVTKPTVIISQEGDKVVIRTLSTFKNTEISFQLGEEFDETTADDRNCKSVVSLDGDKLVHIQKWDGKETNFVREIKDGKMVMTLTFGDVVAVRHYEKA

  • Molecular Weight

    Approximately 16 kDa, based on SDS-PAGE under reducing conditions.

  • Purity

    ≥ 95%, as determined by reducing SDS-PAGE.

Product Properties

Appearance

Lyophilized powder

Formulation

1.Lyophilized from a 0.22 μm filtered solution of 20 mM PB, 150 mM NaCl, pH 7.4.
2.Lyophilized from a 0.22 μm filtered solution of 20mM PB, 10% Trehalose, 100mM NaCl, 0.05% Tween 80, pH 7.5.
Please refer to the lot-specific COA for specific buffer information.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

References

Calculators

Reconstitution Calculator

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) Volume (to add to vial)
=
Mass (in vial) Mass (in vial)
÷
Desired Reconstitution Concentration Desired Reconstitution Concentration
Dilution Calculator

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

Concentration (start) Concentration (start)
×
Volume (start) Volume (start)
=
Concentration (final) Concentration (final)
×
Volume (final) Volume (final)
The Specific Activity Calculator Equation
  • Specific Activity (Unit/mg)
  • Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) Specific Activity (Unit/mg)
Unit/mg
= 106 ÷
Biological Activity (ED50) Biological Activity (ED50)
106 ÷
ng/mL
MOQ
Minimum order quantity
100 mg

Get Quote In-stock

Other size
Get Quote
Please select quantity
Amount: USD 0.00