FABP7 Protein, Human (His)
Based on 1 Customer Validation
FABP7 Protein, Human (His) expresses in E. coliwith a His tag. Fatty Acid-Binding Protein 7 (FABP-7) is one of the subtypes of FABPs and preferentially binds to n-3 and n-9 polyunsaturated fatty acids (PUFAs) such as docosahexaenotic acid (DHA) and oleic acid, respectively. FABP-7 is thought to be an important molecule for cell proliferation in healthy as well as diseased organisms.
- Species: Human
- Source: E. coli
-
Storage:Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
To place orders, for customer services and technical support, please contact: MedChemExpress USA
Tel: 609-228-6898 E-mail: [email protected] [email protected]
-
Biological Activity
-
Technical Parameters
-
Product Properties
- Documentation
- References
- Help & FAQs
Biological Activity
FABP7 Protein, Human (His) expresses in E. coliwith a His tag. Fatty Acid-Binding Protein 7 (FABP-7) is one of the subtypes of FABPs and preferentially binds to n-3 and n-9 polyunsaturated fatty acids (PUFAs) such as docosahexaenotic acid (DHA) and oleic acid, respectively. FABP-7 is thought to be an important molecule for cell proliferation in healthy as well as diseased organisms[1].
FABP-7 is a well-known marker of neural stem cells and radial glia in the CNS. In the embryonic brain, FABP7 is essential for the maintenance and proliferation of neural stem-progenitor cells and radial glia[2].
Technical Parameters
-
Species Human
-
Source E. coli
-
Tag N-6*His
-
Accession
O15540-1 (V2-A132)
-
Molecular Construction
-
N-term
-
6*His
-
FABP7 (V2-A132)
Accession # O15540-1 -
C-term
-
-
Protein Length
Full Length of Isoform-1
-
Synonyms
FABP7; MRG; Fatty Acid Binding Protein 7; Mammary-Derived Growth Inhibitor-Related; B-FABP; Mammary-Derived Growth Inhibitor Related; BLBP; Fatty Acid Binding Protein 7, Brain; Brain-Type Fatty Acid-Binding Protein; Hypothetical Protein DKFZp547J2313; Fat
-
AA Sequence
VEAFCATWKLTNSQNFDEYMKALGVGFATRQVGNVTKPTVIISQEGDKVVIRTLSTFKNTEISFQLGEEFDETTADDRNCKSVVSLDGDKLVHIQKWDGKETNFVREIKDGKMVMTLTFGDVVAVRHYEKA
-
Molecular Weight
Approximately 16 kDa, based on SDS-PAGE under reducing conditions.
-
Purity
≥ 95%, as determined by reducing SDS-PAGE.
Product Properties
Lyophilized powder
1.Lyophilized from a 0.22 μm filtered solution of 20 mM PB, 150 mM NaCl, pH 7.4.
2.Lyophilized from a 0.22 μm filtered solution of 20mM PB, 10% Trehalose, 100mM NaCl, 0.05% Tween 80, pH 7.5.
Please refer to the lot-specific COA for specific buffer information.
<1 EU/μg, determined by LAL method.
It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).
Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Room temperature in continental US; may vary elsewhere.
Documentation
-
Data Sheet (261 KB)
-
SDS (251 KB)
- English - EN (251 KB)
- Français - FR (251 KB)
- Deutsch - DE (251 KB)
- Norwegian - NO (251 KB)
- Español - ES (251 KB)
- Swedish - SV (251 KB)
- Italian - IT (251 KB)
- Korean - KR (251 KB)
- Portuguese - PT (251 KB)
-
Handling Instructions (2659 KB)
References
[1]. Kagawa Y, et al. Role of FABP7 in tumor cell signaling. Adv Biol Regul. 2019;71:206-218. [Content Brief]
[2]. Kamizato K, et al. The role of fatty acid binding protein 7 in spinal cord astrocytes in a mouse model of experimental autoimmune encephalomyelitis. Neuroscience. 2019;409:120-129. [Content Brief]
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
Powered by Bioz
