FAM3C Protein, Human (HEK293, His)
Based on 1 Customer Validation
The FAM3C protein emerged as a potential contributor to different cellular processes with a role in retinal lamination formation, emphasizing its involvement in retinal development. In addition, FAM3C is also involved in promoting epithelial-mesenchymal transition (EMT), indicating its potential impact on cell differentiation and tissue remodeling. FAM3C Protein, Human (HEK293, His) is the recombinant human-derived FAM3C protein, expressed by HEK293 , with C-6*His labeled tag.
- Species: Human
- Source: HEK293
-
Storage:Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
To place orders, for customer services and technical support, please contact: MedChemExpress USA
Tel: 609-228-6898 E-mail: [email protected] [email protected]
-
Biological Activity
-
Technical Parameters
-
Product Properties
- Documentation
- Help & FAQs
Biological Activity
Description
The FAM3C protein emerged as a potential contributor to different cellular processes with a role in retinal lamination formation, emphasizing its involvement in retinal development. In addition, FAM3C is also involved in promoting epithelial-mesenchymal transition (EMT), indicating its potential impact on cell differentiation and tissue remodeling. FAM3C Protein, Human (HEK293, His) is the recombinant human-derived FAM3C protein, expressed by HEK293 , with C-6*His labeled tag.
Background
FAM3C Protein emerges as a potential contributor to distinct cellular processes, with suggested involvement in retinal laminar formation, emphasizing its role in retinal development. Additionally, FAM3C is implicated in promoting epithelial to mesenchymal transition (EMT), indicating its potential impact on cellular differentiation and tissue remodeling. The dual nature of FAM3C's functions, spanning retinal development and EMT processes, underscores its versatility in influencing fundamental aspects of cellular behavior. Delving deeper into the specific mechanisms by which FAM3C modulates retinal laminar formation and EMT could provide valuable insights into its role in tissue development and remodeling, offering potential avenues for understanding its broader implications in physiological and pathological contexts.
Technical Parameters
-
Species Human
-
Source HEK293
-
Tag C-6*His
-
Accession
Q92520 (Q25-D227)
-
Molecular Construction
-
N-term
-
FAM3C (Q25-D227)
Accession # Q92520 -
6*His
-
C-term
-
-
Protein Length
Full Length of Mature Protein
-
Synonyms
FAM3C; Family With Sequence Similarity 3 Member C; FAM3 Metabolism Regulating Signaling Molecule C; Predicted Osteoblast Protein; ILEI; Protein FAM3C; Interleukin-Like EMT Inducer; GS3876; Interleukin-Like Epithelial-Mesenchymal Transition Inducer; GS3786
-
AA Sequence
QVFEIKMDASLGNLFARSALDTAARSTKPPRYKCGISKACPEKHFAFKMASGAANVVGPKICLEDNVLMSGVKNNVGRGINVALANGKTGEVLDTKYFDMWGGDVAPFIEFLKAIQDGTIVLMGTYDDGATKLNDEARRLIADLGSTSITNLGFRDNWVFCGGKGIKTKSPFEQHIKNNKDTNKYEGWPEVVEMEGCIPQKQD
-
Predicted Molecular Mass
23.2 kDa
-
Molecular Weight
Approximately 20-30 kDa, based on SDS-PAGE under reducing conditions, due to the glycosylation.
-
Purity
≥ 95%, as determined by reducing SDS-PAGE.
Product Properties
Lyophilized powder.
1.Lyophilized from a 0.22 μm filtered solution of 20 mM PB, 150 mM NaCl, pH 7.2.
2.Lyophilized from a 0.22 μm filtered solution of 20 mM Citrate, 8% Trehaolse, 5% mannitol, 0.05% Tween 80, pH 4.5.
Please refer to the lot-specific COA for specific buffer information.
<1 EU/μg, determined by LAL method.
It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).
Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Room temperature in continental US; may vary elsewhere.
Documentation
-
Data Sheet (236 KB)
-
SDS (252 KB)
- English - EN (252 KB)
- Français - FR (252 KB)
- Deutsch - DE (252 KB)
- Norwegian - NO (252 KB)
- Español - ES (252 KB)
- Swedish - SV (252 KB)
- Italian - IT (252 KB)
- Korean - KR (252 KB)
- Portuguese - PT (252 KB)
-
Handling Instructions (2659 KB)
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
Powered by Bioz
