FAM3C Protein, Human (HEK293, His)

The FAM3C protein emerged as a potential contributor to different cellular processes with a role in retinal lamination formation, emphasizing its involvement in retinal development. In addition, FAM3C is also involved in promoting epithelial-mesenchymal transition (EMT), indicating its potential impact on cell differentiation and tissue remodeling. FAM3C Protein, Human (HEK293, His) is the recombinant human-derived FAM3C protein, expressed by HEK293 , with C-6*His labeled tag.

FAM3C Protein emerges as a potential contributor to distinct cellular processes, with suggested involvement in retinal laminar formation, emphasizing its role in retinal development. Additionally, FAM3C is implicated in promoting epithelial to mesenchymal transition (EMT), indicating its potential impact on cellular differentiation and tissue remodeling. The dual nature of FAM3C's functions, spanning retinal development and EMT processes, underscores its versatility in influencing fundamental aspects of cellular behavior. Delving deeper into the specific mechanisms by which FAM3C modulates retinal laminar formation and EMT could provide valuable insights into its role in tissue development and remodeling, offering potential avenues for understanding its broader implications in physiological and pathological contexts.

Human

HEK293

C-6*His

Q92520 (Q25-D227)

10447  [NCBI]

Full Length of Mature Protein

QVFEIKMDASLGNLFARSALDTAARSTKPPRYKCGISKACPEKHFAFKMASGAANVVGPKICLEDNVLMSGVKNNVGRGINVALANGKTGEVLDTKYFDMWGGDVAPFIEFLKAIQDGTIVLMGTYDDGATKLNDEARRLIADLGSTSITNLGFRDNWVFCGGKGIKTKSPFEQHIKNNKDTNKYEGWPEVVEMEGCIPQKQD

Approximately 20-25 kDa, based on SDS-PAGE under reducing conditions, due to the glycosylation.

≥ 95%, as determined by reducing SDS-PAGE.

Lyophilized powder.

1.Lyophilized from a 0.22 μm filtered solution of 20 mM PB, 150 mM NaCl, pH 7.2.
2.Lyophilized from a 0.22 μm filtered solution of 20 mM Citrate, 8% Trehaolse, 5% mannitol, 0.05% Tween 80, pH 4.5.
Please refer to the lot-specific COA for specific buffer information.

<1 EU/μg, determined by LAL method.

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH₂O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Room temperature in continental US; may vary elsewhere.