1. Recombinant Proteins
  2. Cytokines and Growth Factors
  3. FAM3D Protein, Human (199a.a, HEK293, His)

FAM3D Protein, Human (199a.a, HEK293, His)

Cat. No.: HY-P70890
COA Handling Instructions

FAM3D Protein exhibits high expression in the placenta but has low expression levels in the small intestine. FAM3D Protein, Human (199a.a, HEK293, His) is the recombinant human-derived FAM3D protein, expressed by HEK293, with C-6*His labeled tag. The total length of FAM3D Protein, Human (199a.a, HEK293, His) is 199 a.a., with molecular weight of ~26.0 kDa.

For research use only. We do not sell to patients.

Protein Expression Service

Size Price Stock Quantity
10 μg $110 In-stock
50 μg $310 In-stock
100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products

Publications Citing Use of MCE FAM3D Protein, Human (199a.a, HEK293, His)

  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

FAM3D Protein exhibits high expression in the placenta but has low expression levels in the small intestine. FAM3D Protein, Human (199a.a, HEK293, His) is the recombinant human-derived FAM3D protein, expressed by HEK293, with C-6*His labeled tag. The total length of FAM3D Protein, Human (199a.a, HEK293, His) is 199 a.a., with molecular weight of ~26.0 kDa.

Background

FAM3D protein is prominently expressed in the placenta and demonstrates relatively low expression levels in the small intestine.

Species

Human

Source

HEK293

Tag

C-6*His

Accession

Q96BQ1 (Y26-F224)

Gene ID
Molecular Construction
N-term
FAM3D (Y26-F224)
Accession # Q96BQ1
6*His
C-term
Synonyms
Protein FAM3D; FAM3D
AA Sequence

YMSFSMKTIRLPRWLAASPTKEIQVKKYKCGLIKPCPANYFAFKICSGAANVVGPTMCFEDRMIMSPVKNNVGRGLNIALVNGTTGAVLGQKAFDMYSGDVMHLVKFLKEIPGGALVLVASYDDPGTKMNDESRKLFSDLGSSYAKQLGFRDSWVFIGAKDLRGKSPFEQFLKNSPDTNKYEGWPELLEMEGCMPPKPF

Molecular Weight

Approximately 26.0 kDa

Purity

Greater than 95% as determined by reducing SDS-PAGE.

Appearance

Solution.

Formulation

Supplied as a 0.2 μm filtered solution of 20 mM PB, 150 mM NaCl, pH 7.2.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Storage & Stability

Stored at -80°C for 1 year. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.

Shipping

Shipping with dry ice.

Documentation

FAM3D Protein, Human (199a.a, HEK293, His) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Salutation

Applicant Name *

 

Email Address *

Phone Number *

 

Organization Name *

Department *

 

Requested quantity *

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
FAM3D Protein, Human (199a.a, HEK293, His)
Cat. No.:
HY-P70890
Quantity:
MCE Japan Authorized Agent: