FAM3D Protein, Human (HEK293, His)
Based on 1 publication(s) in Google Scholar
FAM3D Protein exhibits high expression in the placenta but has low expression levels in the small intestine. FAM3D Protein, Human (199a.a, HEK293, His) is the recombinant human-derived FAM3D protein, expressed by HEK293 , with C-6*His labeled tag.
- Species: Human
- Source: HEK293
-
Storage:Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.
To place orders, for customer services and technical support, please contact: MedChemExpress USA
Tel: 609-228-6898 E-mail: [email protected] [email protected]
-
Biological Activity
-
Technical Parameters
-
Product Properties
- Documentation
- Help & FAQs
Biological Activity
Description
FAM3D Protein exhibits high expression in the placenta but has low expression levels in the small intestine. FAM3D Protein, Human (199a.a, HEK293, His) is the recombinant human-derived FAM3D protein, expressed by HEK293 , with C-6*His labeled tag.
Background
FAM3D protein is prominently expressed in the placenta and demonstrates relatively low expression levels in the small intestine.
MCE Validation Data
-
Purity - SDS-PAGE
Purity - SDS-PAGE
Publications (1)
-
Journal Impact Factor
-
Most Recent
-
Kaohsiung J Med Sci
2023 Mar;39(3):254-265. PMID: 36524461
Technical Parameters
-
Species Human
-
Source HEK293
-
Tag C-6*His
-
Accession
Q96BQ1 (Y26-F224)
-
Molecular Construction
-
N-term
-
FAM3D (Y26-F224)
Accession # Q96BQ1 -
6*His
-
C-term
-
-
Protein Length
Full Length of Mature Protein
-
Synonyms
FAM3D; Oncoprotein-Induced Transcript 1; FAM3 Metabolism Regulating Signaling Molecule D; Protein FAM3D; OIT1; Family With Sequence Similarity 3, Member D; EF7; Cytokine-Like Protein EF-7; Family With Sequence Similarity 3 Member D
-
AA Sequence
YMSFSMKTIRLPRWLAASPTKEIQVKKYKCGLIKPCPANYFAFKICSGAANVVGPTMCFEDRMIMSPVKNNVGRGLNIALVNGTTGAVLGQKAFDMYSGDVMHLVKFLKEIPGGALVLVASYDDPGTKMNDESRKLFSDLGSSYAKQLGFRDSWVFIGAKDLRGKSPFEQFLKNSPDTNKYEGWPELLEMEGCMPPKPF
-
Predicted Molecular Mass
23.1 kDa
-
Molecular Weight
Approximately 26-27 kDa, based on SDS-PAGE under reducing conditions, due to the glycosylation.
-
Glycosylation
Yes
-
Purity
≥ 95%, as determined by reducing SDS-PAGE.
Product Properties
Solution
Supplied as a 0.22 μm filtered solution of 20 mM PB, 150 mM NaCl, pH 7.2.
<1 EU/μg, determined by LAL method.
Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.
Shipping with dry ice.
Documentation
-
Data Sheet (235 KB)
-
SDS (252 KB)
- English - EN (252 KB)
- Français - FR (252 KB)
- Deutsch - DE (252 KB)
- Norwegian - NO (252 KB)
- Español - ES (252 KB)
- Swedish - SV (252 KB)
- Italian - IT (252 KB)
- Korean - KR (252 KB)
- Portuguese - PT (252 KB)
-
Handling Instructions (2659 KB)
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
Powered by Bioz
