1. Protéines recombinantes
  2. CD Antigens Fc Receptors
  3. Macrophage CD Proteins Monocyte CD Proteins Platelet CD Proteins Dendritic Cell CD Proteins Fc-gamma Receptor
  4. Fc gamma RII/CD32
  5. FCGR2A/CD32a
  6. Fc gamma RIIA/CD32a Protein, Cynomolgus (HEK293, His)

Fc gamma RIIA/CD32a protein belongs to the FC family of receptor proteins and is a type 1 transmembrane glycoprotein that binds immunoglobulin subtypes IgG1-4 and can bind c-reactive protein (CRP) with high affinity. It plays an important role in immune regulation in many infections, including malaria. Fc gamma RIIA/CD32a Protein, Cynomolgus (HEK293, His) is the recombinant cynomolgus-derived Fc gamma RIIA/CD32a protein, expressed by HEK293 , with C-His labeled tag.

Nos produits utilisent uniquement pour la recherche. Nous ne vendons pas aux patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Prix Stock Quantité
Échantillon gratuit   Apply now
Échantillon gratuit   Apply now
20 μg En stock
50 μg En stock
100 μg   Obtenir un devis  

* Veuillez sélectionner la quantité avant d'ajouter des articles.

Top Publications Citing Use of Products
  • Activité biologique

  • Paramètres Techniques

  • Propriétés

  • Description

  • Références

Description

Fc gamma RIIA/CD32a protein belongs to the FC family of receptor proteins and is a type 1 transmembrane glycoprotein that binds immunoglobulin subtypes IgG1-4 and can bind c-reactive protein (CRP) with high affinity. It plays an important role in immune regulation in many infections, including malaria. Fc gamma RIIA/CD32a Protein, Cynomolgus (HEK293, His) is the recombinant cynomolgus-derived Fc gamma RIIA/CD32a protein, expressed by HEK293 , with C-His labeled tag.

Background

Fc gamma RIIA/CD32a Protein contains a polymorphic variant (H/R131) that is associated with susceptibility variability in bacterial diseases and Plasmodium falciparum parasitemia. Fc gamma RIIA/CD32a Protein is a low-affinity IgG receptor that binds immunoglobulin subtypes IgG1-4 and can bind c-reactive protein (CRP) with high affinity, playing an important role in immune regulation[1].
Fc gamma RIIA/CD32a Protein inhibits the production of type I and type III Interferons in human marrow immune cells[2].
Fc gamma RIIA/CD32a protein promotes phagocytosis of opsonized antigens, further promoting immune defense mechanisms[3].

Activité biologique

Rituximab captured on CM5 Chip via Protein A can bind Cynomolgus Fc gamma RIIA, His Tag with an affinity constant of 3.65 μM as determined in SPR assay (Biacore T200).

Species

Cynomolgus

Source

HEK293

Tag

C-8*His

Accession

Q8SPW4 (Q28-P208)

Gene ID
Molecular Construction
N-term
CD32a (Q28-P208)
Accession # Q8SPW4
8*His
C-term
Protein Length

Partial

Synonyms
CD32MGC23887; CDw32fc-gamma-RIIa; Fc gamma RIIA; FCG2; Fc-gamma-RIIa; FcGR; FCGR2; FCGR2A; FCGR2A1; FcgRIIA; FCRIIA; fcRII-a; IGFR2MGC30032; IgG Fc receptor II-a; FCG2; CD32A
AA Sequence

QTAPPKAVLKLEPPWINVLREDSVTLTCGGAHSPDSDSTQWFHNGNRIPTHTQPSYRFKANNNDSGEYRCQTGRTSLSDPVHLTVLSEWLALQTPHLEFREGETIMLRCHSWKDKPLIKVTFFQNGIAKKFSHMDPNFSIPQANHSHSGDYHCTGNIGYTPYSSKPVTITVQVPSVGSSSP

Masse moléculaire

30-40 kDa

Pureté

≥ 95%, as determined by Bis-Tris PAGE.

Appearance

Lyophilized powder.

Formulation

Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4, 5% trehalose.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O.

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Livraison

Room temperature in continental US; may vary elsewhere.

Documentation
Références
Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Vos produits récemment consultés:

Demande en ligne

Your information is safe with us. * Required Fields.

Fc gamma RIIA/CD32a Protein, Cynomolgus (HEK293, His)

 

Requested Quantity *

Nom du demandeur *

 

Civilité

Adresse e-mail *

 

Numéro de téléphone *

Department

 

Nom de l'organisation *

City

État

Country or Region *

     

Remarques

Bulk Inquiry

Inquiry Information

Nom du produit:
Fc gamma RIIA/CD32a Protein, Cynomolgus (HEK293, His)
Cat. No.:
HY-P78265
Quantité:
MCE Japan Authorized Agent: