Fc gamma RIIA/CD32a Protein, Cynomolgus (Biotinylated, HEK293, His-Avi)

Fc gamma RIIA/CD32a protein belongs to the FC family of receptor proteins and is a type 1 transmembrane glycoprotein that binds immunoglobulin subtypes IgG1-4 and can bind c-reactive protein (CRP) with high affinity. It plays an important role in immune regulation in many infections, including malaria. Fc gamma RIIA/CD32a Protein, Cynomolgus (Biotinylated, HEK293, His-Avi) is the recombinant cynomolgus-derived Fc gamma RIIA/CD32a protein, expressed by HEK293 , with C-Avi, C-His labeled tag.

Fc gamma RIIA/CD32a Protein contains a polymorphic variant (H/R131) that is associated with susceptibility variability in bacterial diseases and Plasmodium falciparum parasitemia. Fc gamma RIIA/CD32a Protein is a low-affinity IgG receptor that binds immunoglobulin subtypes IgG1-4 and can bind c-reactive protein (CRP) with high affinity, playing an important role in immune regulation^[1].
Fc gamma RIIA/CD32a Protein inhibits the production of type I and type III Interferons in human marrow immune cells^[2].
Fc gamma RIIA/CD32a protein promotes phagocytosis of opsonized antigens, further promoting immune defense mechanisms^[3].

Cynomolgus

HEK293

C-Avi;C-His

Q8SPW4 (A30-G204)

102143568  [NCBI]

Partial

Biotin

APPKAVLKLEPPWINVLREDSVTLTCGGAHSPDSDSTQWFHNGNRIPTHTQPSYRFKANNNDSGEYRCQTGRTSLSDPVHLTVLSEWLALQTPHLEFREGETIMLRCHSWKDKPLIKVTFFQNGIAKKFSHMDPNFSIPQANHSHSGDYHCTGNIGYTPYSSKPVTITVQVPSVG

Approximately 33-35 kDa,based on SDS-PAGE under reducing conditions,due to the glycosylation.

≥ 95%, as determined by reducing SDS-PAGE.

<1 EU/μg, determined by LAL method.