1. Recombinant Proteins
  2. CD Antigens Fc Receptors Biotinylated Proteins
  3. Macrophage CD Proteins Monocyte CD Proteins Platelet CD Proteins Dendritic Cell CD Proteins Fc-gamma Receptor
  4. Fc gamma RII/CD32
  5. FCGR2A/CD32a
  6. Fc gamma RIIA/CD32a Protein, Cynomolgus (Biotinylated, HEK293, His-Avi)

Fc gamma RIIA/CD32a Protein, Cynomolgus (Biotinylated, HEK293, His-Avi)

Cat. No.: HY-P75642
Handling Instructions Technical Support

Fc gamma RIIA/CD32a protein belongs to the FC family of receptor proteins and is a type 1 transmembrane glycoprotein that binds immunoglobulin subtypes IgG1-4 and can bind c-reactive protein (CRP) with high affinity. It plays an important role in immune regulation in many infections, including malaria. Fc gamma RIIA/CD32a Protein, Cynomolgus (Biotinylated, HEK293, His-Avi) is the recombinant cynomolgus-derived Fc gamma RIIA/CD32a protein, expressed by HEK293 , with C-Avi, C-His labeled tag.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Stock
50 μg   Get quote  
100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

Fc gamma RIIA/CD32a protein belongs to the FC family of receptor proteins and is a type 1 transmembrane glycoprotein that binds immunoglobulin subtypes IgG1-4 and can bind c-reactive protein (CRP) with high affinity. It plays an important role in immune regulation in many infections, including malaria. Fc gamma RIIA/CD32a Protein, Cynomolgus (Biotinylated, HEK293, His-Avi) is the recombinant cynomolgus-derived Fc gamma RIIA/CD32a protein, expressed by HEK293 , with C-Avi, C-His labeled tag.

Background

Fc gamma RIIA/CD32a Protein contains a polymorphic variant (H/R131) that is associated with susceptibility variability in bacterial diseases and Plasmodium falciparum parasitemia. Fc gamma RIIA/CD32a Protein is a low-affinity IgG receptor that binds immunoglobulin subtypes IgG1-4 and can bind c-reactive protein (CRP) with high affinity, playing an important role in immune regulation[1].
Fc gamma RIIA/CD32a Protein inhibits the production of type I and type III Interferons in human marrow immune cells[2].
Fc gamma RIIA/CD32a protein promotes phagocytosis of opsonized antigens, further promoting immune defense mechanisms[3].

Species

Cynomolgus

Source

HEK293

Tag

C-Avi;C-His

Accession

Q8SPW4 (A30-G204)

Gene ID
Molecular Construction
N-term
CD32a (A30-G204)
Accession # Q8SPW4
Avi-6*His
C-term
Protein Length

Partial

Conjugation

Biotin

Synonyms
Low Affinity Immunoglobulin Gamma Fc Region Receptor II-a; CD32; FCGR2A; FCG2; IGFR2
AA Sequence

APPKAVLKLEPPWINVLREDSVTLTCGGAHSPDSDSTQWFHNGNRIPTHTQPSYRFKANNNDSGEYRCQTGRTSLSDPVHLTVLSEWLALQTPHLEFREGETIMLRCHSWKDKPLIKVTFFQNGIAKKFSHMDPNFSIPQANHSHSGDYHCTGNIGYTPYSSKPVTITVQVPSVG

Predicted Molecular Mass
22.9 kDa
Molecular Weight

Approximately 33-35 kDa,based on SDS-PAGE under reducing conditions,due to the glycosylation.

Purity

≥ 95%, as determined by reducing SDS-PAGE.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Documentation
Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Fc gamma RIIA/CD32a Protein, Cynomolgus (Biotinylated, HEK293, His-Avi)

 

Requested Quantity *

Applicant Name *

 

Salutation

Email Address *

 

Phone Number *

Department

 

Organization Name *

City

State

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
Fc gamma RIIA/CD32a Protein, Cynomolgus (Biotinylated, HEK293, His-Avi)
Cat. No.:
HY-P75642
Quantity:
MCE Japan Authorized Agent: