1. Recombinant Proteins
  2. Fc Receptors Biotinylated Proteins
  3. Fc-gamma Receptor
  4. Fc gamma RIII/CD16
  5. Fc gamma RIII/CD16 Protein, Rhesus Macaque (Biotinylated, HEK293, His-Avi)

Fc gamma RIII/CD16 Protein, Rhesus Macaque (Biotinylated, HEK293, His-Avi)

Cat. No.: HY-P77313
Handling Instructions Technical Support

The Fc gamma RIII/CD16 protein is a receptor for IgG and is optimally activated upon binding to aggregated antigen-IgG complexes, initiating antibody-dependent cellular cytotoxicity (ADCC) and preventing inappropriate effector cell activation. It mediates IgG effector functions on NK cells, generating memory-like adaptive NK cells to efficiently eliminate virally infected cells. Fc gamma RIII/CD16 Protein, Rhesus Macaque (Biotinylated, HEK293, His-Avi) is the recombinant Rhesus Macaque-derived Fc gamma RIII/CD16 protein, expressed by HEK293 , with C-Avi, C-His labeled tag.

연구목적의 판매만을 진행합니다. 환자를 대상으로 한 판매는 하지 않습니다.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

사이즈 재고
50 μg   견적 받기  
100 μg   견적 받기  

* 장바구니에 담기 전 물품의 수량을 선택해 주십시오.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • 제품 설명

제품 설명

The Fc gamma RIII/CD16 protein is a receptor for IgG and is optimally activated upon binding to aggregated antigen-IgG complexes, initiating antibody-dependent cellular cytotoxicity (ADCC) and preventing inappropriate effector cell activation. It mediates IgG effector functions on NK cells, generating memory-like adaptive NK cells to efficiently eliminate virally infected cells. Fc gamma RIII/CD16 Protein, Rhesus Macaque (Biotinylated, HEK293, His-Avi) is the recombinant Rhesus Macaque-derived Fc gamma RIII/CD16 protein, expressed by HEK293 , with C-Avi, C-His labeled tag.

Background

Fc gamma RIII/CD16 Protein serves as a receptor for the invariable Fc fragment of immunoglobulin gamma (IgG) and is optimally activated upon binding clustered antigen-IgG complexes displayed on cell surfaces, initiating the process of antibody-dependent cellular cytotoxicity (ADCC) leading to the lysis of antibody-coated cells. It does not bind free monomeric IgG, thereby avoiding inappropriate effector cell activation in the absence of an antigenic trigger. This receptor mediates IgG effector functions on natural killer (NK) cells, binding antigen-IgG complexes generated during infection to trigger NK cell-dependent cytokine production and degranulation, limiting viral load and propagation. Fc gamma RIII/CD16 is crucial in generating memory-like adaptive NK cells capable of producing high amounts of IFNG, efficiently eliminating virus-infected cells via ADCC, and regulating NK cell survival and proliferation by preventing NK cell progenitor apoptosis. As an Fc-binding subunit, it associates with CD247 and/or FCER1G adapters to form functional signaling complexes, initiating intracellular signaling cascades that drive NK cell activation. The ITAM-dependent signaling coupled with receptor phosphorylation by PKC mediates robust intracellular calcium flux, leading to the production of pro-inflammatory cytokines. Additionally, Fc gamma RIII/CD16 costimulates NK cells and triggers the lysis of target cells independently of IgG binding, mediating the antitumor activities of therapeutic antibodies. It also plays a role in enhanced ADCC in response to afucosylated IgGs. The protein forms a heterooligomeric complex with ITAM-containing signaling subunits, including homodimers of CD247 or FCER1G, or a heterodimer of CD247 and FCER1G, to constitute a functional receptor complex. Fc gamma RIII/CD16 interacts with the Fc region of antigen-complexed IgG, showing a preference for IgG1 and IgG3 isotypes. It further interacts with CD2, contributing to NK cell activation and cytotoxicity, and with S100A4, inhibiting PKC-dependent phosphorylation of FCGR3A.

Species

Rhesus Macaque

Source

HEK293

Tag

C-Avi;C-His

Accession

NP_001258584.1 (G17-Q208)

Gene ID
Molecular Construction
N-term
Fc gamma RIII/CD16 (G17-Q208)
Accession # NP_001258584.1
Avi-His
C-term
Protein Length

Partial

Conjugation

Biotin

Synonyms
Low affinity immunoglobulin gamma Fc region receptor III; FcRIII; FCGR3
AA Sequence

GMRAEDLPKAVVFLEPQWYRVLEKDSVTLKCQGAYSPEDNSTRWFHNESLISSQTSSYFIAAARVNNSGEYRCQTSLSTLSDPVQLEVHIGWLLLQAPRWVFKEEESIHLRCHSWKNTLLHKVTYLQNGKGRKYFHQNSDFYIPKATLKDSGSYFCRGLIGSKNVSSETVNITITQDLAVSSISSFFPPGYQ

Predicted Molecular Mass
25.3 kDa
Glycosylation
Yes
Purity

≥ 90%, as determined by reducing SDS-PAGE.

Endotoxin Level

<1 EU/μg, determined by LAL method.

각종 서류

Fc gamma RIII/CD16 Protein, Rhesus Macaque (Biotinylated, HEK293, His-Avi) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

최근 본 상품:

온라인 문의

Your information is safe with us. * Required Fields.

Fc gamma RIII/CD16 Protein, Rhesus Macaque (Biotinylated, HEK293, His-Avi)

 

Requested Quantity *

고객명 *

 

호칭

메일주소 *

 

전화번호 *

Department

 

회사명 *

City

Country or Region *

     

비고

대량구매 문의

Inquiry Information

상품명:
Fc gamma RIII/CD16 Protein, Rhesus Macaque (Biotinylated, HEK293, His-Avi)
Cat. No.:
HY-P77313
수량:
MCE Japan Authorized Agent: