1. Recombinant Proteins
  2. Fc Receptors
  3. Fc-gamma Receptor
  4. Fc gamma RIII/CD16
  5. Fc gamma RIII/CD16 Protein, Rhesus Macaque (HEK293, His)

Fc gamma RIII/CD16 Protein, Rhesus Macaque (HEK293, His)

Cat. No.: HY-P77314
Handling Instructions Technical Support

The Fc gamma RIII/CD16 protein is a receptor for IgG and is optimally activated upon binding to aggregated antigen-IgG complexes, initiating antibody-dependent cellular cytotoxicity (ADCC) and preventing inappropriate effector cell activation. It mediates IgG effector functions on NK cells, generating memory-like adaptive NK cells to efficiently eliminate virally infected cells. Fc gamma RIII/CD16 Protein, Rhesus Macaque (HEK293, His) is the recombinant Rhesus Macaque-derived Fc gamma RIII/CD16 protein, expressed by HEK293 , with C-His labeled tag.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Price Stock Quantity
Free Sample   Apply now
5 μg In-stock
10 μg In-stock
50 μg In-stock
100 μg In-stock
> 100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

The Fc gamma RIII/CD16 protein is a receptor for IgG and is optimally activated upon binding to aggregated antigen-IgG complexes, initiating antibody-dependent cellular cytotoxicity (ADCC) and preventing inappropriate effector cell activation. It mediates IgG effector functions on NK cells, generating memory-like adaptive NK cells to efficiently eliminate virally infected cells. Fc gamma RIII/CD16 Protein, Rhesus Macaque (HEK293, His) is the recombinant Rhesus Macaque-derived Fc gamma RIII/CD16 protein, expressed by HEK293 , with C-His labeled tag.

Background

Fc gamma RIII/CD16 Protein serves as a receptor for the invariable Fc fragment of immunoglobulin gamma (IgG) and is optimally activated upon binding clustered antigen-IgG complexes displayed on cell surfaces, initiating the process of antibody-dependent cellular cytotoxicity (ADCC) leading to the lysis of antibody-coated cells. It does not bind free monomeric IgG, thereby avoiding inappropriate effector cell activation in the absence of an antigenic trigger. This receptor mediates IgG effector functions on natural killer (NK) cells, binding antigen-IgG complexes generated during infection to trigger NK cell-dependent cytokine production and degranulation, limiting viral load and propagation. Fc gamma RIII/CD16 is crucial in generating memory-like adaptive NK cells capable of producing high amounts of IFNG, efficiently eliminating virus-infected cells via ADCC, and regulating NK cell survival and proliferation by preventing NK cell progenitor apoptosis. As an Fc-binding subunit, it associates with CD247 and/or FCER1G adapters to form functional signaling complexes, initiating intracellular signaling cascades that drive NK cell activation. The ITAM-dependent signaling coupled with receptor phosphorylation by PKC mediates robust intracellular calcium flux, leading to the production of pro-inflammatory cytokines. Additionally, Fc gamma RIII/CD16 costimulates NK cells and triggers the lysis of target cells independently of IgG binding, mediating the antitumor activities of therapeutic antibodies. It also plays a role in enhanced ADCC in response to afucosylated IgGs. The protein forms a heterooligomeric complex with ITAM-containing signaling subunits, including homodimers of CD247 or FCER1G, or a heterodimer of CD247 and FCER1G, to constitute a functional receptor complex. Fc gamma RIII/CD16 interacts with the Fc region of antigen-complexed IgG, showing a preference for IgG1 and IgG3 isotypes. It further interacts with CD2, contributing to NK cell activation and cytotoxicity, and with S100A4, inhibiting PKC-dependent phosphorylation of FCGR3A.

Biological Activity

Measured by its binding ability in a functional ELISA. Immobilized Rhesus CD16 at 10 μg/mL (100 μL/well) can bind Biotinylated Human lgG. The ED50 for this effect is 0.2155 μg/mL.

  • Measured by its binding ability in a functional ELISA. Immobilized Rhesus CD16 at 10 μg/mL (100 μL/well) can bind Biotinylated Human lgG. The ED50 for this effect is 0.2155 μg/mL.
Species

Rhesus Macaque

Source

HEK293

Tag

C-His

Accession

A3RFZ7 (G17-G206)

Gene ID
Molecular Construction
N-term
CD16 (G17-G206)
Accession # A3RFZ7
His
C-term
Protein Length

Extracellular Domain

Synonyms
Low affinity immunoglobulin gamma Fc region receptor III; FcRIII; FCGR3
AA Sequence

GMRAEDLPKAVVFLEPQWYRVLEKDSVTLKCQGAYSPEDNSTRWFHNESLISSQTSSYFIAAARVNNSGEYRCQTSLSTLSDPVQLEVHIGWLLLQAPRWVFKEEESIHLRCHSWKNTLLHKVTYLQNGKGRKYFHQNSDFYIPKATLKDSGSYFCRGLIGSKNVSSETVNITITQDLAVSSISSFFPPG

Molecular Weight

Approximately 32-41 kDa.

Glycosylation
Yes
Purity
  • Greater than 95% as determined by reducing SDS-PAGE.
Appearance

Lyophilized powder

Formulation

Lyophilized from a 0.2 μm filtered solution of PBS, pH 7.4. Normally 5 % - 8 % trehalose, mannitol and 0.01% Tween 80 are added as protectants before lyophilization.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O.

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Documentation

Fc gamma RIII/CD16 Protein, Rhesus Macaque (HEK293, His) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Requested Quantity *

Applicant Name *

 

Salutation

Email Address *

 

Phone Number *

Department

 

Organization Name *

City

State

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
Fc gamma RIII/CD16 Protein, Rhesus Macaque (HEK293, His)
Cat. No.:
HY-P77314
Quantity:
MCE Japan Authorized Agent: