1. Recombinant Proteins
  2. CD Antigens Fc Receptors Biotinylated Proteins
  3. T Cell CD Proteins NK Cell CD Proteins Macrophage CD Proteins Monocyte CD Proteins Stem Cell CD Proteins Dendritic Cell CD Proteins Fc-gamma Receptor
  4. FcγRIIIB/CD16b Fc gamma RIII/CD16
  5. Fc gamma RIIIB/CD16b Protein, Human (Biotinylated, NA1, HEK293, His-Avi)

Fc gamma RIIIB/CD16b Protein, Human (Biotinylated, NA1, HEK293, His-Avi)

Cat. No.: HY-P78881
Handling Instructions Technical Support

Fc gamma RIIIB/CD16b exhibits monoamine oxidase activity, showing specific preference for substrates such as 2-phenylethylamine and tryptamine. In addition to its enzymatic function, there are indications that Fc gamma RIIIB/CD16b may contribute to adipogenesis, suggesting a potential role in the complex regulation of adipose tissue development. Fc gamma RIIIB/CD16b Protein, Human (Biotinylated, NA1, HEK293, His-Avi) is the recombinant human-derived Fc gamma RIIIB/CD16b, expressed by HEK293 , with C-Avi, C-His labeled tag.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Stock
50 μg   Get quote  
100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

Fc gamma RIIIB/CD16b exhibits monoamine oxidase activity, showing specific preference for substrates such as 2-phenylethylamine and tryptamine. In addition to its enzymatic function, there are indications that Fc gamma RIIIB/CD16b may contribute to adipogenesis, suggesting a potential role in the complex regulation of adipose tissue development. Fc gamma RIIIB/CD16b Protein, Human (Biotinylated, NA1, HEK293, His-Avi) is the recombinant human-derived Fc gamma RIIIB/CD16b, expressed by HEK293 , with C-Avi, C-His labeled tag.

Background

The Fc gamma RIIIB, also known as CD16b, is a receptor protein with diverse functions. In addition to its known roles in immune responses as an Fc receptor for IgG antibodies, Fc gamma RIIIB possesses monoamine oxidase activity, specifically targeting substrates such as 2-phenylethylamine and tryptamine. This enzymatic capability suggests a potential involvement in the metabolism of monoamine neurotransmitters. Furthermore, Fc gamma RIIIB may play a role in adipogenesis, the process by which fat cells differentiate and mature. Additionally, its potential critical modulatory role in signal transmission within the retina suggests its participation in visual processes. Ongoing research may further elucidate the intricate functions and regulatory mechanisms of Fc gamma RIIIB in various physiological contexts.

Species

Human

Source

HEK293

Tag

C-Avi;C-His

Accession

AAA35881.1 (G17-S200)

Gene ID

2215

Protein Length

Partial

Conjugation

Biotin

Synonyms
Fc gamma RIIIB ; CD16b (NA1); FCGR3B; CD16B; FCG3B; FCGR3; FCG3; IGFR3
AA Sequence

GMRTEDLPKAVVFLEPQWYRVLEKDSVTLKCQGAYSPEDNSTQWFHNENLISSQASSYFIDAATVDDSGEYRCQTNLSTLSDPVQLEVHVGWLLLQAPRWVFKEEDPIHLRCHSWKNTALHKVTYLQNGKDRKYFHHNSDFHIPKATLKDSGSYFCRGLVGSKNVSSETVNITITQGLAVSTIS

Predicted Molecular Mass
23.8 kDa
Molecular Weight

Approximately 43-53 kDa,based on SDS-PAGE under reducing conditions,due to the glycosylation.

Glycosylation
Yes
Purity

≥ 95%, as determined by reducing SDS-PAGE.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Documentation
Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Fc gamma RIIIB/CD16b Protein, Human (Biotinylated, NA1, HEK293, His-Avi)

 

Requested Quantity *

Applicant Name *

 

Salutation

Email Address *

 

Phone Number *

Department

 

Organization Name *

City

State

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
Fc gamma RIIIB/CD16b Protein, Human (Biotinylated, NA1, HEK293, His-Avi)
Cat. No.:
HY-P78881
Quantity:
MCE Japan Authorized Agent: