FCMR/FAIM3 Protein, Human (HEK293, Fc)

The FCMR/FAIM3 protein plays a critical role in immune system processes and uniquely protects against FAS, TNF alpha, and FADD-induced apoptosis. Unlike traditional apoptosis inhibitors, FCMR/FAIM3 activates the inhibitory pathway and prevents CASP8 activation after FAS stimulation. FCMR/FAIM3 Protein, Human (HEK293, Fc) is the recombinant human-derived FCMR/FAIM3 protein, expressed by HEK293 , with C-hFc labeled tag. The total length of FCMR/FAIM3 Protein, Human (HEK293, Fc) is 234 a.a., with molecular weight of ~66 kDa.

FCMR/FAIM3 protein emerges as a pivotal player in immune system processes, exhibiting a unique protective function against apoptosis induced by FAS, TNF alpha, and FADD. Intriguingly, rather than relying on the conventional upregulation of apoptosis inhibitors such as BCL2 and BCLXL, FCMR/FAIM3 appears to activate an inhibitory pathway that effectively prevents CASP8 activation upon FAS stimulation. This distinctive mechanism underscores its role in dampening apoptotic signals at an upstream level. Furthermore, its inhibitory action extends to FAS-induced apoptosis by orchestrating CFLAR up-regulation, highlighting its multifaceted involvement in modulating apoptotic pathways. The nuanced functions of FCMR/FAIM3 position it as a key regulator in immune responses, shedding light on potential therapeutic targets for conditions involving dysregulated apoptosis.

Human

HEK293

C-hFc

O60667-1/NP_005440.1 (R18-G251)

9214  [NCBI]

Extracellular Domain

RILPEVKVEGELGGSVTIKCPLPEMHVRIYLCREMAGSGTCGTVVSTTNFIKAEYKGRVTLKQYPRKNLFLVEVTQLTESDSGVYACGAGMNTDRGKTQKVTLNVHSEYEPSWEEQPMPETPKWFHLPYLFQMPAYASSSKFVTRVTTPAQRGKVPPVHHSSPTTQITHRPRVSRASSVAGDKPRTFLPSTTASKISALEGLLKPQTPSYNHHTRLHRQRALDYGSQSGREGQG

Approximately 65 kDa, based on SDS-PAGE under reducing conditions, due to the glycosylation.

≥ 80%, as determined by reducing SDS-PAGE.

<1 EU/μg, determined by LAL method.