1. Recombinant Proteins
  2. Others
  3. Fetuin A/AHSG Protein, Macaca mulatta (HEK293, His)

Fetuin A/AHSG Protein, Macaca mulatta (HEK293, His)

Cat. No.: HY-P70183
Handling Instructions Technical Support

Fetuin A/AHSG Protein is a heterodimeric plasma glycoprotein containing an A-chain of 282 amino acids and a B-chain of 27 amino acid residues linked by a single inter-disulfide bond. Fetuin A is a plasma carrier protein that helps to transport and make a wide range of substances available in the bloodstream. Fetuin A is a hepatokine which has the capacity to prevent vascular calcification. Fetuin A is a multifunctional protein that plays important roles in diabetes, kidney disease, and cancer, as well as in inhibition of ectopic calcification. Fetuin A/AHSG Protein, Macaca mulatta (HEK293, His) is the recombinant Fetuin A/AHSG protein, expressed by HEK293 , with C-10*His labeled tag.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Price Stock Quantity
10 μg In-stock
50 μg In-stock
100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

Fetuin A/AHSG Protein is a heterodimeric plasma glycoprotein containing an A-chain of 282 amino acids and a B-chain of 27 amino acid residues linked by a single inter-disulfide bond. Fetuin A is a plasma carrier protein that helps to transport and make a wide range of substances available in the bloodstream. Fetuin A is a hepatokine which has the capacity to prevent vascular calcification. Fetuin A is a multifunctional protein that plays important roles in diabetes, kidney disease, and cancer, as well as in inhibition of ectopic calcification[1][2][3]. Fetuin A/AHSG Protein, Macaca mulatta (HEK293, His) is the recombinant Fetuin A/AHSG protein, expressed by HEK293 , with C-10*His labeled tag.

Background

The molecular weight of Fetuin A ranges from 51 to 67 kDa, depending on the degree of glycosylation. It is a negatively charged glycoprotein circulating in the blood and extracellular fluid with several days of half-life[1].
Fetuin A is a hepatic secretory glycoprotein that promotes insulin resistance by inhibiting the insulin receptor tyrosine kinase in skeletal muscle and hepatocytes, serving as an adaptor protein for saturated fatty acids and allowing them to activate Toll-like receptor 4 (TLR4), thereby inducing inflammatory signaling and insulin resistance. Fetuin A inhibits soft tissue calcification through binding of small clusters of calcium and phosphate. Fetuin A enhances phagocytosis of extracellular vesicles and apoptotic cells by vascular smooth muscle cells and macrophages, reducing both apoptosis and calcification in cells subjected to elevated extracellular concentrations of mineral ions[1].
Fetuin A binds with a plethora of receptors and exhibits multifaceted physiological and pathological functions. It is involved in the regulation of calcium metabolism, osteogenesis, and the insulin signaling pathway. It also acts as an ectopic calcification inhibitor, protease inhibitor, inflammatory mediator, anti-inflammatory partner, atherogenic factor, and adipogenic factor, among other several moonlighting functions[2].

Species

Others

Source

HEK293

Tag

C-10*His

Accession

A0A2K6AQI2 (A19-V367)

Gene ID

105480162  [NCBI]

Molecular Construction
N-term
AHSG (A19-V367)
Accession # A0A2K6AQI2
10*His
C-term
Synonyms
rMaAlpha-2-HS-glycoprotein/Fetuin A; Fetuin A; AHSG
AA Sequence

APHGPGLIYRQPNCDDPETEEAALVAVDYINQNLPWGYKHTLNQIDEVKVWPQQPFGEMFEIEIDTLETTCHVLDPTPVAGCRVRQLKEHAVEGDCDFQLLKVNGKFSVEYAKCDSSPDSAEDVRKVCRDCPLLAPLNDTRVVHAAEAAVTAFNAQNNGSNFQLEEISRAQLVPLPPSTYVEFTISGTDCVAKEATEAANCNLLAKKQYGFCKATLNEKLGGEEVAVTCTVFQTQPATSQPQPEGANEAVPTPVVDADAPASYPVGASGPLPTGSPIYAHVLAAAPPVVPIHSSHYDLRHLFMGVVSLRSPSGEALHPRKTRSVVQPSVGAAAGPVVPPCPGRVRHFKV

Molecular Weight

Approximately 50.4 kDa

Purity

Greater than 95% as determined by reducing SDS-PAGE.

Appearance

Lyophilized powder.

Formulation

Lyophilized from a 0.2 μm filtered solution of PBS, pH 7.4.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Documentation

Fetuin A/AHSG Protein, Macaca mulatta (HEK293, His) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Requested Quantity *

Applicant Name *

 

Salutation

Email Address *

 

Phone Number *

Department

 

Organization Name *

City

State

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
Fetuin A/AHSG Protein, Macaca mulatta (HEK293, His)
Cat. No.:
HY-P70183
Quantity:
MCE Japan Authorized Agent: