Fetuin A/AHSG Protein, Macaca mulatta (HEK293, His)

Fetuin A/AHSG Protein is a heterodimeric plasma glycoprotein containing an A-chain of 282 amino acids and a B-chain of 27 amino acid residues linked by a single inter-disulfide bond. Fetuin A is a plasma carrier protein that helps to transport and make a wide range of substances available in the bloodstream. Fetuin A is a hepatokine which has the capacity to prevent vascular calcification. Fetuin A is a multifunctional protein that plays important roles in diabetes, kidney disease, and cancer, as well as in inhibition of ectopic calcification^[1][2][3]. Fetuin A/AHSG Protein, Macaca mulatta (HEK293, His) is the recombinant Fetuin A/AHSG protein, expressed by HEK293 , with C-10*His labeled tag. The total length of Fetuin A/AHSG Protein, Macaca mulatta (HEK293, His) is 349 a.a., with molecular weight of ~50.4 kDa.

The molecular weight of Fetuin A ranges from 51 to 67 kDa, depending on the degree of glycosylation. It is a negatively charged glycoprotein circulating in the blood and extracellular fluid with several days of half-life^[1].
Fetuin A is a hepatic secretory glycoprotein that promotes insulin resistance by inhibiting the insulin receptor tyrosine kinase in skeletal muscle and hepatocytes, serving as an adaptor protein for saturated fatty acids and allowing them to activate Toll-like receptor 4 (TLR4), thereby inducing inflammatory signaling and insulin resistance. Fetuin A inhibits soft tissue calcification through binding of small clusters of calcium and phosphate. Fetuin A enhances phagocytosis of extracellular vesicles and apoptotic cells by vascular smooth muscle cells and macrophages, reducing both apoptosis and calcification in cells subjected to elevated extracellular concentrations of mineral ions^[1].
Fetuin A binds with a plethora of receptors and exhibits multifaceted physiological and pathological functions. It is involved in the regulation of calcium metabolism, osteogenesis, and the insulin signaling pathway. It also acts as an ectopic calcification inhibitor, protease inhibitor, inflammatory mediator, anti-inflammatory partner, atherogenic factor, and adipogenic factor, among other several moonlighting functions^[2].

Others

HEK293

C-10*His

A0A2K6AQI2 (A19-V367)

105480162  [NCBI]

APHGPGLIYRQPNCDDPETEEAALVAVDYINQNLPWGYKHTLNQIDEVKVWPQQPFGEMFEIEIDTLETTCHVLDPTPVAGCRVRQLKEHAVEGDCDFQLLKVNGKFSVEYAKCDSSPDSAEDVRKVCRDCPLLAPLNDTRVVHAAEAAVTAFNAQNNGSNFQLEEISRAQLVPLPPSTYVEFTISGTDCVAKEATEAANCNLLAKKQYGFCKATLNEKLGGEEVAVTCTVFQTQPATSQPQPEGANEAVPTPVVDADAPASYPVGASGPLPTGSPIYAHVLAAAPPVVPIHSSHYDLRHLFMGVVSLRSPSGEALHPRKTRSVVQPSVGAAAGPVVPPCPGRVRHFKV

Approximately 50.4 kDa

Greater than 95% as determined by reducing SDS-PAGE.

Lyophilized powder.

Lyophilized from a 0.2 μm filtered solution of PBS, pH 7.4.

<1 EU/μg, determined by LAL method.

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH₂O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Stored at -20°C for 2 years. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Room temperature in continental US; may vary elsewhere.