Fetuin A/AHSG Protein, Macaca nemestrina (HEK293, His)

Customer Review

Based on 1 Customer Validation

Fetuin A/AHSG Protein is a heterodimeric plasma glycoprotein containing an A-chain of 282 amino acids and a B-chain of 27 amino acid residues linked by a single inter-disulfide bond. Fetuin A is a plasma carrier protein that helps to transport and make a wide range of substances available in the bloodstream. Fetuin A is a hepatokine which has the capacity to prevent vascular calcification. Fetuin A is a multifunctional protein that plays important roles in diabetes, kidney disease, and cancer, as well as in inhibition of ectopic calcification. Fetuin A/AHSG Protein, Macaca nemestrina (HEK293, His) is the recombinant Fetuin A/AHSG protein, expressed by HEK293 , with C-10*His labeled tag.

For research use only. We do not sell to patients.
  • Species: Others
  • Source: HEK293
  • Storage:
    Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
  • Biological Activity
  • Technical Parameters
  • Product Properties
  • Documentation
  • Help & FAQs

Biological Activity

Description

Fetuin A/AHSG Protein is a heterodimeric plasma glycoprotein containing an A-chain of 282 amino acids and a B-chain of 27 amino acid residues linked by a single inter-disulfide bond. Fetuin A is a plasma carrier protein that helps to transport and make a wide range of substances available in the bloodstream. Fetuin A is a hepatokine which has the capacity to prevent vascular calcification. Fetuin A is a multifunctional protein that plays important roles in diabetes, kidney disease, and cancer, as well as in inhibition of ectopic calcification[1][2][3]. Fetuin A/AHSG Protein, Macaca nemestrina (HEK293, His) is the recombinant Fetuin A/AHSG protein, expressed by HEK293 , with C-10*His labeled tag.

Background

The molecular weight of Fetuin A ranges from 51 to 67 kDa, depending on the degree of glycosylation. It is a negatively charged glycoprotein circulating in the blood and extracellular fluid with several days of half-life[1].
Fetuin A is a hepatic secretory glycoprotein that promotes insulin resistance by inhibiting the insulin receptor tyrosine kinase in skeletal muscle and hepatocytes, serving as an adaptor protein for saturated fatty acids and allowing them to activate Toll-like receptor 4 (TLR4), thereby inducing inflammatory signaling and insulin resistance. Fetuin A inhibits soft tissue calcification through binding of small clusters of calcium and phosphate. Fetuin A enhances phagocytosis of extracellular vesicles and apoptotic cells by vascular smooth muscle cells and macrophages, reducing both apoptosis and calcification in cells subjected to elevated extracellular concentrations of mineral ions[1].
Fetuin A binds with a plethora of receptors and exhibits multifaceted physiological and pathological functions. It is involved in the regulation of calcium metabolism, osteogenesis, and the insulin signaling pathway. It also acts as an ectopic calcification inhibitor, protease inhibitor, inflammatory mediator, anti-inflammatory partner, atherogenic factor, and adipogenic factor, among other several moonlighting functions[2].

MCE Validation Data

  • Purity - SDS-PAGE

    Purity - SDS-PAGE

    ≥ 95%, as determined by reducing SDS-PAGE.

Technical Parameters

  • Species Others
  • Source HEK293
  • Tag C-10*His
  • Accession
  • Gene ID
  • Molecular Construction
    • N-term
    • AHSG (A19-V367)
      Accession # A0A2K6AQI2
    • 10*His
    • C-term
  • Protein Length

    Full Length of Mature Protein

  • Synonyms

    AHSG; HSGA; Alpha 2-HS Glycoprotein; Ba-Alpha-2-Glycoprotein; FETUA; Alpha-2-Z-Globulin; Alpha-2-HS-Glycoprotein; Fetuin A; Fetuin-A; APMR1; A2HS; AHS

  • AA Sequence

    APHGPGLIYRQPNCDDPETEEAALVAVDYINQNLPWGYKHTLNQIDEVKVWPQQPFGEMFEIEIDTLETTCHVLDPTPVAGCRVRQLKEHAVEGDCDFQLLKVNGKFSVEYAKCDSSPDSAEDVRKVCRDCPLLAPLNDTRVVHAAEAAVTAFNAQNNGSNFQLEEISRAQLVPLPPSTYVEFTISGTDCVAKEATEAANCNLLAKKQYGFCKATLNEKLGGEEVAVTCTVFQTQPATSQPQPEGANEAVPTPVVDADAPASYPVGASGPLPTGSPIYAHVLAAAPPVVPIHSSHYDLRHLFMGVVSLRSPSGEALHPRKTRSVVQPSVGAAAGPVVPPCPGRVRHFKV

  • Predicted Molecular Mass

    38.9 kDa

  • Molecular Weight

    Approximately 45-70 kDa, based on SDS-PAGE under reducing conditions.

  • Purity

    ≥ 95%, as determined by reducing SDS-PAGE.

Product Properties

Appearance

Lyophilized powder.

Formulation

Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Calculators

Reconstitution Calculator

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) Volume (to add to vial)
=
Mass (in vial) Mass (in vial)
÷
Desired Reconstitution Concentration Desired Reconstitution Concentration
Dilution Calculator

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

Concentration (start) Concentration (start)
×
Volume (start) Volume (start)
=
Concentration (final) Concentration (final)
×
Volume (final) Volume (final)
The Specific Activity Calculator Equation
  • Specific Activity (Unit/mg)
  • Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) Specific Activity (Unit/mg)
Unit/mg
= 106 ÷
Biological Activity (ED50) Biological Activity (ED50)
106 ÷
ng/mL
MOQ
Minimum order quantity
100 mg

Get Quote In-stock

Other size
Get Quote
Please select quantity
Amount: USD 0.00