Fetuin B Protein, Mouse (HEK293, His)

Revisión del cliente

Based on 1 Customer Validation

Fetub Protein, a glycoprotein, plays a significant role in regulating insulin sensitivity and lipid metabolism. Dysregulation of Fetub Protein has been associated with several diseases, including obesity and type 2 diabetes. Fetuin B Protein, Mouse (HEK293, His) is the recombinant mouse-derived Fetuin B protein, expressed by HEK293 , with C-His labeled tag.

Para uso exclusivo en investigación. No vendemos a pacientes.
  • Species: Mouse
  • Source: HEK293
  • Almacenamiento:
    Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
  • Actividad biológica
  • Technical Parameters
  • Product Properties
  • Documentación
  • Help & FAQs

Actividad biológica

Descripciòn

Fetub Protein, a glycoprotein, plays a significant role in regulating insulin sensitivity and lipid metabolism. Dysregulation of Fetub Protein has been associated with several diseases, including obesity and type 2 diabetes. Fetuin B Protein, Mouse (HEK293, His) is the recombinant mouse-derived Fetuin B protein, expressed by HEK293 , with C-His labeled tag.

Background

Fetub protein is an essential protease inhibitor involved in the process of egg fertilization. Its primary role is to prevent the premature hardening of the zona pellucida before fertilization can take place. This is likely achieved through the inhibition of ASTL, a protease responsible for cleaving ZP2 and initiating the hardening of the zona pellucida.

Technical Parameters

  • Species Mouse
  • Source HEK293
  • Tag C-His
  • Accession
  • Gene ID
  • Molecular Construction
    • N-term
    • Fetuin B (R19-P388)
      Accession # Q9QXC1
    • His
    • C-term
  • Protein Length

    Full Length of Mature Protein

  • Synonyms

    FETUB; 16G2; Fetuin B; Gugu; Fetuin-Like Protein IRL685; IRL685; Fetuin-B

  • AA Sequence

    RSPPAPPLPQRPLSPLHPLGCNDSEVLAVAGFALQNINRDQKDGYMLSLNRVHDVREHYQEDMGSLFYLTLDVLETDCHVLSRKAQKDCKPRMFYESVYGQCKAMFHINKPRRVLYLPAYNCTLRPVSKRKTHTTCPDCPSPIDLSNPSALEAATESLAKFNSKSPSKKYELVKVTKAMNQWVSGPAYYVEYLIKEAPCTKSQASCSLQHSDSEPVGICQGSTVQSSLRHVPLIQPVEKSVTVTCEFFESQAQVPGDENPAVTQGPQKLPQKNTAPTSSPSVTAPRGSIQHLPELDDEKPEESKGGSPEEAFPVQLDLTTNPQGDTLDVSFLYLEPGDKKLVVLPFPGKEQRSAECPGPEKENNPLVLPP

  • Peso molecular

    Approximately 55-60 kDa, based on SDS-PAGE under reducing conditions, due to the glycosylation.

  • Glycosylation

    Yes

  • Pureza

    ≥ 95%, as determined by reducing SDS-PAGE.

Product Properties

Appearance

Lyophilized powder.

Formulation

Lyophilized from a 0.22 μm filtered solution of 20 mM Tris, 150 mM NaCl, pH 7.5.
Note: For SPR assay, please replace the buffer. Primary amine components (e.g., Tris, imidazole) can affect protein-coupled chips.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Envío

Room temperature in continental US; may vary elsewhere.

Calculators

Reconstitution Calculator

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) Volume (to add to vial)
=
Mass (in vial) Mass (in vial)
÷
Desired Reconstitution Concentration Desired Reconstitution Concentration
Calculadora de dilución

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

Concentration (start) Concentration (start)
×
Volume (start) Volume (start)
=
Concentration (final) Concentration (final)
×
Volume (final) Volume (final)
The Specific Activity Calculator Equation
  • Specific Activity (Unit/mg)
  • Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) Specific Activity (Unit/mg)
Unit/mg
= 106 ÷
Biological Activity (ED50) Biological Activity (ED50)
106 ÷
ng/mL
MOQ
Minimum order quantity
100 mg

Obtener un presupuesto En stock

Other size
Obtener un presupuesto
Please select quantity
Amount: USD 0.00