Fetuin B Protein, Mouse (HEK293, His)

Fetub Protein, a glycoprotein, plays a significant role in regulating insulin sensitivity and lipid metabolism. Dysregulation of Fetub Protein has been associated with several diseases, including obesity and type 2 diabetes. Fetuin B Protein, Mouse (HEK293, His) is the recombinant mouse-derived Fetuin B protein, expressed by HEK293 , with C-His labeled tag. The total length of Fetuin B Protein, Mouse (HEK293, His) is 370 a.a., with molecular weight of 55-65 kDa.

Fetub protein is an essential protease inhibitor involved in the process of egg fertilization. Its primary role is to prevent the premature hardening of the zona pellucida before fertilization can take place. This is likely achieved through the inhibition of ASTL, a protease responsible for cleaving ZP2 and initiating the hardening of the zona pellucida.

Mouse

HEK293

C-His

Q9QXC1-1 (R19-P388)

59083  [NCBI]

RSPPAPPLPQRPLSPLHPLGCNDSEVLAVAGFALQNINRDQKDGYMLSLNRVHDVREHYQEDMGSLFYLTLDVLETDCHVLSRKAQKDCKPRMFYESVYGQCKAMFHINKPRRVLYLPAYNCTLRPVSKRKTHTTCPDCPSPIDLSNPSALEAATESLAKFNSKSPSKKYELVKVTKAMNQWVSGPAYYVEYLIKEAPCTKSQASCSLQHSDSEPVGICQGSTVQSSLRHVPLIQPVEKSVTVTCEFFESQAQVPGDENPAVTQGPQKLPQKNTAPTSSPSVTAPRGSIQHLPELDDEKPEESKGGSPEEAFPVQLDLTTNPQGDTLDVSFLYLEPGDKKLVVLPFPGKEQRSAECPGPEKENNPLVLPP

55-65 kDa

• 
  Greater than 95% as determined by reducing SDS-PAGE.

Lyophilized powder

Lyophilized from a 0.2 μm filtered solution of 20 mM Tris, 150 mM NaCl, pH 7.5.

<1 EU/μg, determined by LAL method.

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH₂O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Stored at -20°C for 2 years. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Room temperature in continental US; may vary elsewhere.