FGF-17 Protein, Mouse (His)
Based on 1 Customer Validation
The FGF-17 Protein is crucial in regulating embryonic development, functioning as a signaling molecule for inducing and patterning the embryonic brain. It plays an essential role in normal brain development and interacts specifically with FGFR3 and FGFR4 receptors, pivotal in this developmental process. FGF-17 Protein, Mouse (His) is the recombinant mouse-derived FGF-17, expressed by E. coli, with C-6*His labeled tag. The total length of FGF-17 Protein, Mouse (His) is 194 a.a..
- Species: Mouse
- Source: E. coli
-
Storage:Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Biological Activity
Description
The FGF-17 Protein is crucial in regulating embryonic development, functioning as a signaling molecule for inducing and patterning the embryonic brain. It plays an essential role in normal brain development and interacts specifically with FGFR3 and FGFR4 receptors, pivotal in this developmental process. FGF-17 Protein, Mouse (His) is the recombinant mouse-derived FGF-17, expressed by E. coli, with C-6*His labeled tag. The total length of FGF-17 Protein, Mouse (His) is 194 a.a..
Background
The FGF-17 protein plays a vital role in the regulation of embryonic development, serving as a signaling molecule for the induction and patterning of the embryonic brain. It is essential for normal brain development and interacts with FGFR3 and FGFR4, two receptors involved in this process.
Verified Bioactivity
Measured in a cell proliferation assay using NIH 3T3 mouse fibroblast cells. The ED50 for this effect is 61.38 ng/mL, in the presence of 10 µg/mL heparin, corresponding to a specific activity is 1.63×104 units/mg.
Technical Parameters
-
Species Mouse
-
Source E. coli
-
Tag C-6*His
-
Accession
P63075 (T23-T216)
-
Molecular Construction
-
N-term
-
FGF-17 (T23-T216)
Accession # P63075 -
6*His
-
C-term
-
-
Protein Length
Full Length of Mature Protein
-
Synonyms
FGF17; FGF-17; Fibroblast Growth Factor 17; HH20; FGF-13
-
AA Sequence
TQGENHPSPNFNQYVRDQGAMTDQLSRRQIREYQLYSRTSGKHVQVTGRRISATAEDGNKFAKLIVETDTFGSRVRIKGAESEKYICMNKRGKLIGKPSGKSKDCVFTEIVLENNYTAFQNARHEGWFMAFTRQGRPRQASRSRQNQREAHFIKRLYQGQLPFPNHAERQKQFEFVGSAPTRRTKRTRRPQSQT
-
Predicted Molecular Mass
22.5 kDa
-
Molecular Weight
Approximately 24 kDa, based on SDS-PAGE under reducing conditions.
-
Purity
≥ 95%, as determined by reducing SDS-PAGE.
Product Properties
Lyophilized powder.
Lyophilized from a 0.22 μm filtered solution of 50 mM Tris-HCl, 1 M NaCl, pH 8.5.
Note: For SPR assay, please replace the buffer. Primary amine components (e.g., Tris, imidazole) can affect protein-coupled chips.
<1 EU/μg, determined by LAL method.
It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).
Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Room temperature in continental US; may vary elsewhere.
Documentation
-
Data Sheet (260 KB)
-
SDS (251 KB)
- English - EN (251 KB)
- Français - FR (251 KB)
- Deutsch - DE (251 KB)
- Norwegian - NO (251 KB)
- Español - ES (251 KB)
- Swedish - SV (251 KB)
- Italian - IT (251 KB)
- Korean - KR (251 KB)
- Portuguese - PT (251 KB)
-
Handling Instructions (2659 KB)
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)